Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   EO946_RS12475 Genome accession   NZ_CP034943
Coordinates   2431442..2431873 (-) Length   143 a.a.
NCBI ID   WP_003226321.1    Uniprot ID   -
Organism   Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2426442..2436873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EO946_RS12425 (EO946_12425) sinI 2426637..2426810 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  EO946_RS12430 (EO946_12430) sinR 2426844..2427179 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EO946_RS12435 (EO946_12435) tasA 2427273..2428058 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  EO946_RS12440 (EO946_12440) sipW 2428122..2428694 (-) 573 WP_003226338.1 signal peptidase I SipW -
  EO946_RS12445 (EO946_12445) tapA 2428678..2429439 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  EO946_RS12450 (EO946_12450) - 2429708..2430034 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  EO946_RS12455 (EO946_12455) - 2430076..2430255 (-) 180 WP_003226330.1 YqzE family protein -
  EO946_RS12460 (EO946_12460) comGG 2430327..2430701 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  EO946_RS12465 (EO946_12465) comGF 2430702..2431085 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  EO946_RS12470 (EO946_12470) comGE 2431111..2431458 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  EO946_RS12475 (EO946_12475) comGD 2431442..2431873 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  EO946_RS12480 (EO946_12480) comGC 2431863..2432159 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  EO946_RS12485 (EO946_12485) comGB 2432173..2433210 (-) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  EO946_RS12490 (EO946_12490) comGA 2433197..2434267 (-) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  EO946_RS12500 (EO946_12500) - 2434480..2434890 (-) 411 WP_032727412.1 CBS domain-containing protein -
  EO946_RS12505 (EO946_12505) - 2434953..2435906 (-) 954 WP_003226308.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 143 a.a.        Molecular weight: 16022.47 Da        Isoelectric Point: 9.3266

>NTDB_id=333588 EO946_RS12475 WP_003226321.1 2431442..2431873(-) (comGD) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
MNIKLNEEEGFALLESLLVLSLASTLLIAVFTTLPPAYDNTAVRQVAWQLKNDILLAQQTAISSHQRTKILFQRKEYQLV
MGDTVIERPYAKGLSIEPQTLKDRLEFNEKGHPNAGGTIRVKGHAAYDITIYLGSGRVNVERK

Nucleotide


Download         Length: 432 bp        

>NTDB_id=333588 EO946_RS12475 WP_003226321.1 2431442..2431873(-) (comGD) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
TTGAACATTAAATTAAACGAGGAGGAGGGATTTGCCCTTTTAGAAAGCTTGCTCGTGTTAAGCCTCGCCTCTACCCTCCT
GATTGCCGTGTTTACCACACTTCCTCCTGCTTATGACAACACAGCTGTCCGTCAGGTGGCATGGCAGCTGAAAAACGATA
TTTTGCTTGCACAGCAGACTGCAATTTCCAGTCATCAAAGAACAAAAATTCTCTTTCAGAGAAAAGAATATCAATTAGTT
ATGGGTGATACGGTAATTGAACGGCCGTATGCCAAAGGACTTTCTATAGAACCGCAGACATTAAAAGACCGTTTGGAATT
TAATGAGAAAGGGCACCCGAATGCAGGCGGAACAATACGAGTAAAAGGACATGCCGCTTATGACATAACCATTTATTTAG
GGAGCGGGAGAGTCAATGTGGAGAGAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

86.713

100

0.867


Multiple sequence alignment