Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   EO946_RS12430 Genome accession   NZ_CP034943
Coordinates   2426844..2427179 (+) Length   111 a.a.
NCBI ID   WP_003226345.1    Uniprot ID   A0AAE2VGU9
Organism   Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Genomic Context

Location: 2421844..2432179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EO946_RS12405 (EO946_12405) gcvT 2422432..2423520 (-) 1089 WP_003226353.1 glycine cleavage system aminomethyltransferase GcvT -
  EO946_RS12410 (EO946_12410) - 2423963..2425636 (+) 1674 WP_003226350.1 DEAD/DEAH box helicase -
  EO946_RS12415 (EO946_12415) - 2425657..2426451 (+) 795 WP_003226349.1 YqhG family protein -
  EO946_RS12425 (EO946_12425) sinI 2426637..2426810 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  EO946_RS12430 (EO946_12430) sinR 2426844..2427179 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EO946_RS12435 (EO946_12435) tasA 2427273..2428058 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  EO946_RS12440 (EO946_12440) sipW 2428122..2428694 (-) 573 WP_003226338.1 signal peptidase I SipW -
  EO946_RS12445 (EO946_12445) tapA 2428678..2429439 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  EO946_RS12450 (EO946_12450) - 2429708..2430034 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  EO946_RS12455 (EO946_12455) - 2430076..2430255 (-) 180 WP_003226330.1 YqzE family protein -
  EO946_RS12460 (EO946_12460) comGG 2430327..2430701 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  EO946_RS12465 (EO946_12465) comGF 2430702..2431085 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  EO946_RS12470 (EO946_12470) comGE 2431111..2431458 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  EO946_RS12475 (EO946_12475) comGD 2431442..2431873 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  EO946_RS12480 (EO946_12480) comGC 2431863..2432159 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene

Sequence

Protein


Download         Length: 111 a.a.        Molecular weight: 12988.64 Da        Isoelectric Point: 7.2023

>NTDB_id=333584 EO946_RS12430 WP_003226345.1 2426844..2427179(+) (sinR) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEK
LVRDAMTSGVSKKQFREFLDYQKWRKSQKEE

Nucleotide


Download         Length: 336 bp        

>NTDB_id=333584 EO946_RS12430 WP_003226345.1 2426844..2427179(+) (sinR) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
TTGATTGGCCAGCGTATTAAACAATACCGTAAAGAAAAAGGCTACTCACTATCAGAACTAGCTGAAAAAGCTGGGGTAGC
GAAGTCTTATTTAAGCTCAATAGAACGAAATCTACAAACGAACCCCTCCATTCAATTTCTCGAAAAAGTCTCCGCTGTTC
TGGACGTCTCGGTTCATACTTTGCTCGATGAGAAACATGAAACCGAATACGATGGTCAATTAGATAGTGAATGGGAGAAA
TTGGTTCGCGATGCAATGACATCCGGGGTATCGAAAAAACAATTTCGTGAATTTTTAGATTATCAAAAATGGAGAAAATC
CCAAAAAGAGGAGTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(6-58)

Anti-repressor SinI (SinI)

(74-101)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment