Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   EO946_RS12470 Genome accession   NZ_CP034943
Coordinates   2431111..2431458 (-) Length   115 a.a.
NCBI ID   WP_003226323.1    Uniprot ID   E0U415
Organism   Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2426111..2436458
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EO946_RS12425 (EO946_12425) sinI 2426637..2426810 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  EO946_RS12430 (EO946_12430) sinR 2426844..2427179 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EO946_RS12435 (EO946_12435) tasA 2427273..2428058 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  EO946_RS12440 (EO946_12440) sipW 2428122..2428694 (-) 573 WP_003226338.1 signal peptidase I SipW -
  EO946_RS12445 (EO946_12445) tapA 2428678..2429439 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  EO946_RS12450 (EO946_12450) - 2429708..2430034 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  EO946_RS12455 (EO946_12455) - 2430076..2430255 (-) 180 WP_003226330.1 YqzE family protein -
  EO946_RS12460 (EO946_12460) comGG 2430327..2430701 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  EO946_RS12465 (EO946_12465) comGF 2430702..2431085 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  EO946_RS12470 (EO946_12470) comGE 2431111..2431458 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  EO946_RS12475 (EO946_12475) comGD 2431442..2431873 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  EO946_RS12480 (EO946_12480) comGC 2431863..2432159 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  EO946_RS12485 (EO946_12485) comGB 2432173..2433210 (-) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  EO946_RS12490 (EO946_12490) comGA 2433197..2434267 (-) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  EO946_RS12500 (EO946_12500) - 2434480..2434890 (-) 411 WP_032727412.1 CBS domain-containing protein -
  EO946_RS12505 (EO946_12505) - 2434953..2435906 (-) 954 WP_003226308.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13497.51 Da        Isoelectric Point: 4.3472

>NTDB_id=333587 EO946_RS12470 WP_003226323.1 2431111..2431458(-) (comGE) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWDKLIADENMAESREIGYQMMNENISKYMMTGEETEVKMITKNNNNYALK
WEEEGEYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=333587 EO946_RS12470 WP_003226323.1 2431111..2431458(-) (comGE) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTTTGCTGCTGACAGT
CGTTCCTTTGTGGGACAAACTGATAGCTGATGAAAATATGGCGGAATCTCGAGAAATCGGGTACCAAATGATGAATGAAA
ACATTAGCAAATATATGATGACTGGTGAAGAAACTGAGGTGAAAATGATTACAAAGAACAATAATAACTATGCGCTAAAG
TGGGAGGAGGAGGGGGAATATCAAAACGTATGCATATCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGCATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB E0U415

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

83.478

100

0.835

Multiple sequence alignment