Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EO946_RS12425 | Genome accession | NZ_CP034943 |
| Coordinates | 2426637..2426810 (+) | Length | 57 a.a. |
| NCBI ID | WP_003226347.1 | Uniprot ID | G4NQ83 |
| Organism | Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2421637..2431810
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EO946_RS12405 (EO946_12405) | gcvT | 2422432..2423520 (-) | 1089 | WP_003226353.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EO946_RS12410 (EO946_12410) | - | 2423963..2425636 (+) | 1674 | WP_003226350.1 | DEAD/DEAH box helicase | - |
| EO946_RS12415 (EO946_12415) | - | 2425657..2426451 (+) | 795 | WP_003226349.1 | YqhG family protein | - |
| EO946_RS12425 (EO946_12425) | sinI | 2426637..2426810 (+) | 174 | WP_003226347.1 | anti-repressor SinI | Regulator |
| EO946_RS12430 (EO946_12430) | sinR | 2426844..2427179 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| EO946_RS12435 (EO946_12435) | tasA | 2427273..2428058 (-) | 786 | WP_003226340.1 | biofilm matrix protein TasA | - |
| EO946_RS12440 (EO946_12440) | sipW | 2428122..2428694 (-) | 573 | WP_003226338.1 | signal peptidase I SipW | - |
| EO946_RS12445 (EO946_12445) | tapA | 2428678..2429439 (-) | 762 | WP_003226335.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EO946_RS12450 (EO946_12450) | - | 2429708..2430034 (+) | 327 | WP_079996407.1 | YqzG/YhdC family protein | - |
| EO946_RS12455 (EO946_12455) | - | 2430076..2430255 (-) | 180 | WP_003226330.1 | YqzE family protein | - |
| EO946_RS12460 (EO946_12460) | comGG | 2430327..2430701 (-) | 375 | WP_003226328.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EO946_RS12465 (EO946_12465) | comGF | 2430702..2431085 (-) | 384 | WP_032727308.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| EO946_RS12470 (EO946_12470) | comGE | 2431111..2431458 (-) | 348 | WP_003226323.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6632.64 Da Isoelectric Point: 8.6596
>NTDB_id=333583 EO946_RS12425 WP_003226347.1 2426637..2426810(+) (sinI) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=333583 EO946_RS12425 WP_003226347.1 2426637..2426810(+) (sinI) [Bacillus spizizenii ATCC 6633 = JCM 2499 strain ATCC 6633]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
96.491 |
100 |
0.965 |