Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EG882_RS11370 Genome accession   NZ_CP033967
Coordinates   2152363..2152740 (+) Length   125 a.a.
NCBI ID   WP_015240208.1    Uniprot ID   -
Organism   Bacillus velezensis strain 1B-23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2147363..2157740
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG882_RS11335 (EG882_11335) - 2147678..2148628 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  EG882_RS11340 (EG882_11340) comGA 2148821..2149891 (+) 1071 WP_124692840.1 competence type IV pilus ATPase ComGA Machinery gene
  EG882_RS11345 (EG882_11345) comGB 2149878..2150915 (+) 1038 WP_124692841.1 competence type IV pilus assembly protein ComGB Machinery gene
  EG882_RS11350 (EG882_11350) comGC 2150962..2151228 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  EG882_RS11355 (EG882_11355) comGD 2151218..2151655 (+) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  EG882_RS11360 (EG882_11360) comGE 2151639..2151953 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  EG882_RS11365 (EG882_11365) comGF 2151862..2152362 (+) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  EG882_RS11370 (EG882_11370) comGG 2152363..2152740 (+) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  EG882_RS11375 (EG882_11375) - 2152797..2152976 (+) 180 WP_003153093.1 YqzE family protein -
  EG882_RS11380 (EG882_11380) - 2153016..2153345 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  EG882_RS11385 (EG882_11385) tapA 2153604..2154275 (+) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  EG882_RS11390 (EG882_11390) - 2154247..2154831 (+) 585 WP_015240205.1 signal peptidase I -
  EG882_RS11395 (EG882_11395) - 2154896..2155681 (+) 786 WP_007408329.1 TasA family protein -
  EG882_RS11400 (EG882_11400) sinR 2155729..2156064 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  EG882_RS11405 (EG882_11405) sinI 2156098..2156271 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  EG882_RS11410 (EG882_11410) - 2156448..2157242 (-) 795 WP_007408330.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14123.08 Da        Isoelectric Point: 9.9599

>NTDB_id=327477 EG882_RS11370 WP_015240208.1 2152363..2152740(+) (comGG) [Bacillus velezensis strain 1B-23]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=327477 EG882_RS11370 WP_015240208.1 2152363..2152740(+) (comGG) [Bacillus velezensis strain 1B-23]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment