Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | EG882_RS11405 | Genome accession | NZ_CP033967 |
| Coordinates | 2156098..2156271 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 1B-23 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2151098..2161271
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EG882_RS11355 (EG882_11355) | comGD | 2151218..2151655 (+) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| EG882_RS11360 (EG882_11360) | comGE | 2151639..2151953 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| EG882_RS11365 (EG882_11365) | comGF | 2151862..2152362 (+) | 501 | WP_256994853.1 | competence type IV pilus minor pilin ComGF | - |
| EG882_RS11370 (EG882_11370) | comGG | 2152363..2152740 (+) | 378 | WP_015240208.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| EG882_RS11375 (EG882_11375) | - | 2152797..2152976 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| EG882_RS11380 (EG882_11380) | - | 2153016..2153345 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| EG882_RS11385 (EG882_11385) | tapA | 2153604..2154275 (+) | 672 | WP_124692843.1 | amyloid fiber anchoring/assembly protein TapA | - |
| EG882_RS11390 (EG882_11390) | - | 2154247..2154831 (+) | 585 | WP_015240205.1 | signal peptidase I | - |
| EG882_RS11395 (EG882_11395) | - | 2154896..2155681 (+) | 786 | WP_007408329.1 | TasA family protein | - |
| EG882_RS11400 (EG882_11400) | sinR | 2155729..2156064 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| EG882_RS11405 (EG882_11405) | sinI | 2156098..2156271 (-) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| EG882_RS11410 (EG882_11410) | - | 2156448..2157242 (-) | 795 | WP_007408330.1 | YqhG family protein | - |
| EG882_RS11415 (EG882_11415) | - | 2157264..2158934 (-) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| EG882_RS11420 (EG882_11420) | gcvT | 2159358..2160458 (+) | 1101 | WP_042635355.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=327479 EG882_RS11405 WP_003153105.1 2156098..2156271(-) (sinI) [Bacillus velezensis strain 1B-23]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=327479 EG882_RS11405 WP_003153105.1 2156098..2156271(-) (sinI) [Bacillus velezensis strain 1B-23]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |