Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   D2M30_RS12545 Genome accession   NZ_CP032146
Coordinates   2496776..2497153 (-) Length   125 a.a.
NCBI ID   WP_071348016.1    Uniprot ID   A0AAP7N837
Organism   Bacillus amyloliquefaciens strain YP6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2491776..2502153
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D2M30_RS12505 (D2M30_12530) - 2492271..2493065 (+) 795 WP_088613113.1 YqhG family protein -
  D2M30_RS12510 (D2M30_12535) sinI 2493245..2493418 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  D2M30_RS12515 (D2M30_12540) sinR 2493452..2493787 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  D2M30_RS12520 (D2M30_12545) tasA 2493835..2494620 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  D2M30_RS12525 (D2M30_12550) sipW 2494685..2495269 (-) 585 WP_125122955.1 signal peptidase I SipW -
  D2M30_RS12530 (D2M30_12555) tapA 2495241..2495912 (-) 672 WP_125122956.1 amyloid fiber anchoring/assembly protein TapA -
  D2M30_RS12535 (D2M30_12560) - 2496170..2496499 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  D2M30_RS12540 (D2M30_12565) - 2496540..2496719 (-) 180 WP_016938971.1 YqzE family protein -
  D2M30_RS12545 (D2M30_12570) comGG 2496776..2497153 (-) 378 WP_071348016.1 competence type IV pilus minor pilin ComGG Machinery gene
  D2M30_RS12550 (D2M30_12575) comGF 2497155..2497559 (-) 405 WP_185715963.1 competence type IV pilus minor pilin ComGF -
  D2M30_RS12555 (D2M30_12580) comGE 2497564..2497878 (-) 315 WP_125122957.1 competence type IV pilus minor pilin ComGE Machinery gene
  D2M30_RS12560 (D2M30_12585) comGD 2497862..2498299 (-) 438 WP_125122958.1 competence type IV pilus minor pilin ComGD Machinery gene
  D2M30_RS12565 (D2M30_12590) comGC 2498289..2498597 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  D2M30_RS12570 (D2M30_12595) comGB 2498602..2499639 (-) 1038 WP_125122959.1 competence type IV pilus assembly protein ComGB Machinery gene
  D2M30_RS12575 (D2M30_12600) comGA 2499626..2500696 (-) 1071 WP_125122960.1 competence type IV pilus ATPase ComGA Machinery gene
  D2M30_RS12580 (D2M30_12605) - 2500890..2501839 (-) 950 Protein_2448 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14110.13 Da        Isoelectric Point: 10.2027

>NTDB_id=314027 D2M30_RS12545 WP_071348016.1 2496776..2497153(-) (comGG) [Bacillus amyloliquefaciens strain YP6]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMIQGQKTQSGTQRFPYGTVS
FYIGGNDRRETVQVTIKAVTASGTRREAHLLFNHKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=314027 D2M30_RS12545 WP_071348016.1 2496776..2497153(-) (comGG) [Bacillus amyloliquefaciens strain YP6]
ATGTACAAATCAGACGGGTTTATATATCCGGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTATTGGATCGGTGAGAACCTGCTTCAAAACGGCG
CACTGCTGTCAAGCCGTCATATGATACAGGGACAAAAGACTCAGTCGGGCACACAGCGTTTTCCGTACGGAACCGTCTCT
TTTTACATAGGCGGGAACGATCGCCGGGAAACGGTACAAGTTACAATAAAGGCGGTAACAGCATCAGGGACGAGACGGGA
GGCTCACCTTTTATTCAATCATAAGAAGAAACAGCTGATTCAATGGACAGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment