Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D2M30_RS12510 | Genome accession | NZ_CP032146 |
| Coordinates | 2493245..2493418 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain YP6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2488245..2498418
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2M30_RS12495 (D2M30_12520) | gcvT | 2489056..2490156 (-) | 1101 | WP_125122953.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D2M30_RS12500 (D2M30_12525) | - | 2490580..2492250 (+) | 1671 | WP_125122954.1 | DEAD/DEAH box helicase | - |
| D2M30_RS12505 (D2M30_12530) | - | 2492271..2493065 (+) | 795 | WP_088613113.1 | YqhG family protein | - |
| D2M30_RS12510 (D2M30_12535) | sinI | 2493245..2493418 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| D2M30_RS12515 (D2M30_12540) | sinR | 2493452..2493787 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| D2M30_RS12520 (D2M30_12545) | tasA | 2493835..2494620 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| D2M30_RS12525 (D2M30_12550) | sipW | 2494685..2495269 (-) | 585 | WP_125122955.1 | signal peptidase I SipW | - |
| D2M30_RS12530 (D2M30_12555) | tapA | 2495241..2495912 (-) | 672 | WP_125122956.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D2M30_RS12535 (D2M30_12560) | - | 2496170..2496499 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| D2M30_RS12540 (D2M30_12565) | - | 2496540..2496719 (-) | 180 | WP_016938971.1 | YqzE family protein | - |
| D2M30_RS12545 (D2M30_12570) | comGG | 2496776..2497153 (-) | 378 | WP_071348016.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| D2M30_RS12550 (D2M30_12575) | comGF | 2497155..2497559 (-) | 405 | WP_185715963.1 | competence type IV pilus minor pilin ComGF | - |
| D2M30_RS12555 (D2M30_12580) | comGE | 2497564..2497878 (-) | 315 | WP_125122957.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| D2M30_RS12560 (D2M30_12585) | comGD | 2497862..2498299 (-) | 438 | WP_125122958.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=314025 D2M30_RS12510 WP_013352860.1 2493245..2493418(+) (sinI) [Bacillus amyloliquefaciens strain YP6]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=314025 D2M30_RS12510 WP_013352860.1 2493245..2493418(+) (sinI) [Bacillus amyloliquefaciens strain YP6]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |