Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | D1F65_RS05595 | Genome accession | NZ_CP031779 |
| Coordinates | 1113423..1113893 (+) | Length | 156 a.a. |
| NCBI ID | WP_025380777.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CFBR-105 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1103256..1146096 | 1113423..1113893 | within | 0 |
Gene organization within MGE regions
Location: 1103256..1146096
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1F65_RS05520 (D1F65_05520) | - | 1103256..1104641 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| D1F65_RS05525 (D1F65_05525) | - | 1104848..1105528 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| D1F65_RS05530 (D1F65_05530) | - | 1105564..1106283 (-) | 720 | WP_000358220.1 | XRE family transcriptional regulator | - |
| D1F65_RS05535 (D1F65_05535) | - | 1106425..1106643 (+) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| D1F65_RS05540 (D1F65_05540) | - | 1106658..1106966 (+) | 309 | WP_001153965.1 | hypothetical protein | - |
| D1F65_RS05545 (D1F65_05545) | - | 1107123..1107911 (+) | 789 | WP_001148571.1 | phage antirepressor KilAC domain-containing protein | - |
| D1F65_RS05550 (D1F65_05550) | - | 1107928..1108122 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| D1F65_RS05555 (D1F65_05555) | - | 1108326..1108556 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| D1F65_RS14350 | - | 1108606..1108743 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| D1F65_RS05560 (D1F65_05560) | - | 1108736..1108903 (+) | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| D1F65_RS05565 (D1F65_05565) | - | 1108904..1109224 (+) | 321 | WP_000219666.1 | hypothetical protein | - |
| D1F65_RS05570 (D1F65_05570) | - | 1109318..1109578 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| D1F65_RS05575 (D1F65_05575) | - | 1109587..1109850 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| D1F65_RS05580 (D1F65_05580) | - | 1109859..1111802 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| D1F65_RS05585 (D1F65_05585) | - | 1111804..1112724 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| D1F65_RS05590 (D1F65_05590) | - | 1112805..1113422 (+) | 618 | WP_071890040.1 | MBL fold metallo-hydrolase | - |
| D1F65_RS05595 (D1F65_05595) | ssbA | 1113423..1113893 (+) | 471 | WP_025380777.1 | single-stranded DNA-binding protein | Machinery gene |
| D1F65_RS05600 (D1F65_05600) | - | 1113923..1114810 (+) | 888 | WP_000148306.1 | DnaD domain protein | - |
| D1F65_RS05605 (D1F65_05605) | - | 1114817..1115035 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| D1F65_RS05610 (D1F65_05610) | - | 1115044..1115448 (+) | 405 | WP_000401971.1 | RusA family crossover junction endodeoxyribonuclease | - |
| D1F65_RS05615 (D1F65_05615) | - | 1115461..1115829 (+) | 369 | WP_075345438.1 | SA1788 family PVL leukocidin-associated protein | - |
| D1F65_RS05620 (D1F65_05620) | - | 1115833..1116075 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| D1F65_RS14315 | - | 1116087..1116254 (+) | 168 | WP_001624242.1 | hypothetical protein | - |
| D1F65_RS05625 (D1F65_05625) | - | 1116247..1116498 (+) | 252 | WP_001065092.1 | DUF1024 family protein | - |
| D1F65_RS05630 (D1F65_05630) | - | 1116488..1116670 (+) | 183 | WP_000028422.1 | hypothetical protein | - |
| D1F65_RS05635 (D1F65_05635) | - | 1116663..1117205 (+) | 543 | WP_000185659.1 | dUTP pyrophosphatase | - |
| D1F65_RS05640 (D1F65_05640) | - | 1117242..1117448 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| D1F65_RS05645 (D1F65_05645) | - | 1117445..1117828 (+) | 384 | WP_000592229.1 | hypothetical protein | - |
| D1F65_RS05650 (D1F65_05650) | - | 1117828..1118001 (+) | 174 | WP_000595244.1 | transcriptional activator RinB | - |
| D1F65_RS05655 (D1F65_05655) | - | 1118002..1118148 (+) | 147 | WP_000990001.1 | hypothetical protein | - |
| D1F65_RS05660 (D1F65_05660) | - | 1118172..1118594 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| D1F65_RS05665 (D1F65_05665) | - | 1118781..1119275 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| D1F65_RS05670 (D1F65_05670) | - | 1119278..1120573 (+) | 1296 | WP_000273011.1 | PBSX family phage terminase large subunit | - |
| D1F65_RS05675 (D1F65_05675) | - | 1120584..1122122 (+) | 1539 | WP_000909970.1 | phage portal protein | - |
| D1F65_RS05680 (D1F65_05680) | - | 1122129..1123124 (+) | 996 | WP_001133044.1 | minor capsid protein | - |
| D1F65_RS05685 (D1F65_05685) | - | 1123197..1123367 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| D1F65_RS14430 | - | 1123395..1123488 (+) | 94 | Protein_1070 | hypothetical protein | - |
| D1F65_RS05690 (D1F65_05690) | - | 1123476..1124096 (+) | 621 | WP_033853493.1 | DUF4355 domain-containing protein | - |
| D1F65_RS05695 (D1F65_05695) | - | 1124110..1125084 (+) | 975 | WP_000438511.1 | phage major capsid protein | - |
| D1F65_RS05700 (D1F65_05700) | - | 1125106..1125393 (+) | 288 | WP_001114086.1 | hypothetical protein | - |
| D1F65_RS05705 (D1F65_05705) | - | 1125402..1125734 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| D1F65_RS05710 (D1F65_05710) | - | 1125731..1126033 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| D1F65_RS05715 (D1F65_05715) | - | 1126033..1126380 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| D1F65_RS05720 (D1F65_05720) | - | 1126392..1126775 (+) | 384 | WP_000188643.1 | hypothetical protein | - |
| D1F65_RS05725 (D1F65_05725) | - | 1126794..1127375 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| D1F65_RS05730 (D1F65_05730) | - | 1127437..1127802 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| D1F65_RS05735 (D1F65_05735) | - | 1127832..1128176 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| D1F65_RS05740 (D1F65_05740) | - | 1128193..1131657 (+) | 3465 | WP_117374326.1 | hypothetical protein | - |
| D1F65_RS05745 (D1F65_05745) | - | 1131670..1132617 (+) | 948 | WP_000350675.1 | phage tail family protein | - |
| D1F65_RS05750 (D1F65_05750) | - | 1132626..1134527 (+) | 1902 | WP_000156416.1 | SGNH/GDSL hydrolase family protein | - |
| D1F65_RS05755 (D1F65_05755) | - | 1134542..1136452 (+) | 1911 | WP_000066423.1 | hypothetical protein | - |
| D1F65_RS05760 (D1F65_05760) | - | 1136452..1138275 (+) | 1824 | WP_000259596.1 | phage baseplate upper protein | - |
| D1F65_RS05765 (D1F65_05765) | - | 1138275..1138652 (+) | 378 | WP_000705902.1 | DUF2977 domain-containing protein | - |
| D1F65_RS05770 (D1F65_05770) | - | 1138656..1138829 (+) | 174 | WP_001800921.1 | XkdX family protein | - |
| D1F65_RS05775 (D1F65_05775) | - | 1138869..1139168 (+) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| D1F65_RS05780 (D1F65_05780) | - | 1139305..1141203 (+) | 1899 | WP_000524022.1 | glucosaminidase domain-containing protein | - |
| D1F65_RS05785 (D1F65_05785) | - | 1141216..1142454 (+) | 1239 | WP_000276662.1 | BppU family phage baseplate upper protein | - |
| D1F65_RS05790 (D1F65_05790) | - | 1142460..1142855 (+) | 396 | WP_000398868.1 | hypothetical protein | - |
| D1F65_RS05795 (D1F65_05795) | - | 1142911..1143186 (+) | 276 | WP_000351119.1 | phage holin | - |
| D1F65_RS05800 (D1F65_05800) | - | 1143173..1144585 (+) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| D1F65_RS05805 (D1F65_05805) | - | 1144645..1145202 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| D1F65_RS05810 (D1F65_05810) | - | 1145576..1145728 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| D1F65_RS05815 (D1F65_05815) | - | 1145799..1145909 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| D1F65_RS05820 (D1F65_05820) | - | 1145911..1146096 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=311171 D1F65_RS05595 WP_025380777.1 1113423..1113893(+) (ssbA) [Staphylococcus aureus strain CFBR-105]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=311171 D1F65_RS05595 WP_025380777.1 1113423..1113893(+) (ssbA) [Staphylococcus aureus strain CFBR-105]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |