Detailed information NTG0305327

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: DWB97_RS06150
• Genome accession: NZ_CP031274
• Coordinates: 1229431..1229748 (+)
• Length: 105 a.a.
• NCBI ID: WP_037573894.1
• Uniprot ID: A0AAE5W8Q2
• Organism: Staphylococcus chromogenes strain 17A
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1224431..1234748

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DWB97_RS06120 (DWB97_06145)	-	1225218..1225421 (+)	204	WP_037573910.1	YqgQ family protein	-
DWB97_RS06125 (DWB97_06150)	-	1225418..1226404 (+)	987	WP_145400848.1	ROK family glucokinase	-
DWB97_RS06130 (DWB97_06155)	-	1226405..1226716 (+)	312	WP_145400849.1	MTH1187 family thiamine-binding protein	-
DWB97_RS06135 (DWB97_06160)	-	1226730..1227353 (+)	624	WP_145400850.1	MBL fold metallo-hydrolase	-
DWB97_RS06140 (DWB97_06165)	comGA	1227406..1228380 (+)	975	WP_037573899.1	competence type IV pilus ATPase ComGA	Machinery gene
DWB97_RS06145 (DWB97_06170)	comGB	1228349..1229416 (+)	1068	WP_145400851.1	competence type IV pilus assembly protein ComGB	-
DWB97_RS06150 (DWB97_06175)	comGC	1229431..1229748 (+)	318	WP_037573894.1	competence type IV pilus major pilin ComGC	Machinery gene
DWB97_RS06155 (DWB97_06180)	comGD	1229738..1230169 (+)	432	WP_165885688.1	competence type IV pilus minor pilin ComGD	-
DWB97_RS06160 (DWB97_06185)	-	1230362..1230847 (+)	486	WP_165885689.1	competence type IV pilus minor pilin ComGF	-
DWB97_RS06170 (DWB97_06195)	-	1231015..1231536 (+)	522	WP_186433790.1	shikimate kinase	-
DWB97_RS06175 (DWB97_06200)	gcvT	1231689..1232780 (+)	1092	WP_145400855.1	glycine cleavage system aminomethyltransferase GcvT	-
DWB97_RS06180 (DWB97_06205)	gcvPA	1232793..1234142 (+)	1350	WP_145400856.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11801.05 Da
• Isoelectric Point: 9.5646

>NTDB_id=305327 DWB97_RS06150 WP_037573894.1 1229431..1229748(+) (comGC) [Staphylococcus chromogenes strain 17A]
MKLFKKLKENKGFTLIEMLLVLLIISVLLILIIPNIAKQSEHIQKTGCSAQLKLVESQIEAYTLKFNRKPSTIDELVQEG
YIKENQKSCKNGDTIILRGGEAVVS

Nucleotide

• Length: 318 bp

>NTDB_id=305327 DWB97_RS06150 WP_037573894.1 1229431..1229748(+) (comGC) [Staphylococcus chromogenes strain 17A]
ATGAAATTATTTAAAAAGTTAAAAGAAAACAAGGGGTTTACGTTAATTGAAATGCTTTTAGTTTTGTTAATTATAAGTGT
ACTTTTAATACTAATTATCCCTAATATTGCTAAACAATCAGAACATATTCAAAAAACAGGTTGTTCAGCACAACTTAAAT
TAGTCGAAAGTCAAATTGAAGCATATACTTTGAAATTTAATCGAAAACCTTCAACAATCGACGAACTTGTTCAAGAAGGT
TATATCAAAGAAAATCAAAAATCATGCAAAAATGGAGACACCATCATATTACGTGGCGGAGAAGCCGTTGTTTCATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	66.99	98.095	0.657
comGC	Staphylococcus aureus MW2	66.99	98.095	0.657
comYC	Streptococcus gordonii str. Challis substr. CH1	50	81.905	0.41
comGC	Bacillus subtilis subsp. subtilis str. 168	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae D39	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis SK321	49.383	77.143	0.381
comYC	Streptococcus mutans UA140	51.948	73.333	0.381
comYC	Streptococcus mutans UA159	51.948	73.333	0.381
comYC	Streptococcus suis isolate S10	51.316	72.381	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	72.381	0.371