Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DWB96_RS11465 | Genome accession | NZ_CP031271 |
| Coordinates | 2367077..2367547 (-) | Length | 156 a.a. |
| NCBI ID | WP_145375965.1 | Uniprot ID | - |
| Organism | Staphylococcus caprae strain 26D | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2337253..2377729 | 2367077..2367547 | within | 0 |
Gene organization within MGE regions
Location: 2337253..2377729
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DWB96_RS11275 (DWB96_11305) | - | 2337253..2337438 (-) | 186 | WP_030058967.1 | XRE family transcriptional regulator | - |
| DWB96_RS11280 (DWB96_11310) | - | 2337440..2337550 (-) | 111 | WP_145375922.1 | hypothetical protein | - |
| DWB96_RS11285 (DWB96_11315) | - | 2337621..2337773 (-) | 153 | WP_145375924.1 | hypothetical protein | - |
| DWB96_RS11290 (DWB96_11320) | - | 2337913..2339370 (-) | 1458 | WP_145375927.1 | N-acetylmuramoyl-L-alanine amidase | - |
| DWB96_RS11295 (DWB96_11325) | - | 2339380..2339679 (-) | 300 | WP_126493787.1 | phage holin | - |
| DWB96_RS11300 (DWB96_11330) | - | 2339725..2339871 (-) | 147 | WP_126493788.1 | XkdX family protein | - |
| DWB96_RS11305 (DWB96_11335) | - | 2339864..2340244 (-) | 381 | WP_126493789.1 | hypothetical protein | - |
| DWB96_RS11310 (DWB96_11340) | - | 2340259..2341884 (-) | 1626 | WP_145375929.1 | BppU family phage baseplate upper protein | - |
| DWB96_RS11315 (DWB96_11345) | - | 2341939..2343843 (-) | 1905 | Protein_2218 | glucosaminidase domain-containing protein | - |
| DWB96_RS11320 (DWB96_11350) | - | 2343894..2344280 (-) | 387 | WP_126493792.1 | hypothetical protein | - |
| DWB96_RS11325 (DWB96_11355) | - | 2344264..2344644 (-) | 381 | WP_371106825.1 | hypothetical protein | - |
| DWB96_RS11330 (DWB96_11360) | - | 2344699..2345859 (-) | 1161 | WP_126493793.1 | BppU family phage baseplate upper protein | - |
| DWB96_RS11335 (DWB96_11365) | - | 2345873..2347750 (-) | 1878 | WP_126493794.1 | M14 family metallopeptidase | - |
| DWB96_RS11340 (DWB96_11370) | - | 2347751..2349010 (-) | 1260 | WP_126493795.1 | DUF7643 domain-containing protein | - |
| DWB96_RS11345 (DWB96_11375) | - | 2349021..2349980 (-) | 960 | WP_070872845.1 | phage tail domain-containing protein | - |
| DWB96_RS11350 (DWB96_11380) | - | 2349992..2353867 (-) | 3876 | WP_126493796.1 | phage tail protein | - |
| DWB96_RS11355 (DWB96_11385) | - | 2353882..2354226 (-) | 345 | WP_126493797.1 | hypothetical protein | - |
| DWB96_RS11360 (DWB96_11390) | - | 2354271..2354630 (-) | 360 | WP_095323405.1 | tail assembly chaperone | - |
| DWB96_RS11365 (DWB96_11395) | - | 2354691..2355245 (-) | 555 | WP_095323406.1 | phage major tail protein, TP901-1 family | - |
| DWB96_RS11370 (DWB96_11400) | - | 2355291..2355680 (-) | 390 | WP_145375932.1 | hypothetical protein | - |
| DWB96_RS11375 (DWB96_11405) | - | 2355680..2356042 (-) | 363 | WP_145375934.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DWB96_RS11380 (DWB96_11410) | - | 2356044..2356346 (-) | 303 | WP_145375936.1 | hypothetical protein | - |
| DWB96_RS11385 (DWB96_11415) | - | 2356343..2356672 (-) | 330 | WP_145375938.1 | phage head-tail connector protein | - |
| DWB96_RS11390 (DWB96_11420) | - | 2356674..2356943 (-) | 270 | WP_145375940.1 | hypothetical protein | - |
| DWB96_RS11395 (DWB96_11425) | - | 2356965..2357891 (-) | 927 | WP_145375942.1 | phage major capsid protein | - |
| DWB96_RS11400 (DWB96_11430) | - | 2357909..2358523 (-) | 615 | WP_126493804.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DWB96_RS13305 | - | 2358771..2358923 (-) | 153 | WP_167495592.1 | hypothetical protein | - |
| DWB96_RS13310 | - | 2358910..2359068 (-) | 159 | WP_167495593.1 | hypothetical protein | - |
| DWB96_RS11405 (DWB96_11435) | - | 2359068..2360018 (-) | 951 | WP_145375944.1 | minor capsid protein | - |
| DWB96_RS11410 (DWB96_11440) | - | 2360025..2361521 (-) | 1497 | WP_145375946.1 | phage portal protein | - |
| DWB96_RS11415 (DWB96_11445) | - | 2361535..2362815 (-) | 1281 | WP_145375947.1 | PBSX family phage terminase large subunit | - |
| DWB96_RS11420 (DWB96_11450) | - | 2362802..2363239 (-) | 438 | WP_240700737.1 | terminase small subunit | - |
| DWB96_RS11425 (DWB96_11455) | - | 2363493..2363894 (-) | 402 | WP_145376066.1 | hypothetical protein | - |
| DWB96_RS11430 (DWB96_11460) | rinB | 2363968..2364135 (-) | 168 | WP_145375951.1 | transcriptional activator RinB | - |
| DWB96_RS11435 (DWB96_11465) | - | 2364172..2364696 (-) | 525 | WP_145375953.1 | dUTP diphosphatase | - |
| DWB96_RS13315 | - | 2364689..2364859 (-) | 171 | WP_167495594.1 | hypothetical protein | - |
| DWB96_RS11440 (DWB96_11470) | - | 2364852..2365220 (-) | 369 | WP_145375955.1 | hypothetical protein | - |
| DWB96_RS11445 (DWB96_11475) | - | 2365217..2365582 (-) | 366 | WP_145375957.1 | hypothetical protein | - |
| DWB96_RS11450 (DWB96_11480) | - | 2365569..2365778 (-) | 210 | WP_145375959.1 | hypothetical protein | - |
| DWB96_RS11455 (DWB96_11485) | - | 2365791..2366159 (-) | 369 | WP_145375961.1 | SA1788 family PVL leukocidin-associated protein | - |
| DWB96_RS11460 (DWB96_11490) | - | 2366163..2367044 (-) | 882 | WP_145375963.1 | DnaD domain-containing protein | - |
| DWB96_RS11465 (DWB96_11495) | ssbA | 2367077..2367547 (-) | 471 | WP_145375965.1 | single-stranded DNA-binding protein | Machinery gene |
| DWB96_RS11470 (DWB96_11500) | - | 2367548..2368165 (-) | 618 | WP_338123479.1 | MBL fold metallo-hydrolase | - |
| DWB96_RS11475 (DWB96_11505) | - | 2368246..2369169 (-) | 924 | WP_145375969.1 | recombinase RecT | - |
| DWB96_RS11480 (DWB96_11510) | - | 2369171..2371123 (-) | 1953 | WP_145375971.1 | AAA family ATPase | - |
| DWB96_RS11485 (DWB96_11515) | - | 2371522..2372178 (+) | 657 | WP_145375973.1 | hypothetical protein | - |
| DWB96_RS13555 | - | 2372364..2372489 (-) | 126 | WP_338123440.1 | DUF771 domain-containing protein | - |
| DWB96_RS13320 | - | 2372627..2372776 (-) | 150 | WP_167495595.1 | hypothetical protein | - |
| DWB96_RS13325 | - | 2372865..2373041 (-) | 177 | WP_167495596.1 | hypothetical protein | - |
| DWB96_RS11495 (DWB96_11525) | - | 2373057..2373824 (-) | 768 | WP_145375975.1 | phage regulatory protein/antirepressor Ant | - |
| DWB96_RS11500 (DWB96_11530) | - | 2373838..2374062 (-) | 225 | WP_145375977.1 | helix-turn-helix transcriptional regulator | - |
| DWB96_RS11505 (DWB96_11535) | - | 2374220..2374549 (+) | 330 | WP_070487471.1 | helix-turn-helix transcriptional regulator | - |
| DWB96_RS11510 (DWB96_11540) | - | 2374564..2375028 (+) | 465 | WP_145375979.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DWB96_RS11515 (DWB96_11545) | - | 2375042..2375497 (+) | 456 | WP_145375981.1 | DUF6978 family protein | - |
| DWB96_RS11520 (DWB96_11550) | - | 2375511..2376299 (+) | 789 | WP_145375982.1 | DUF1828 domain-containing protein | - |
| DWB96_RS11525 (DWB96_11555) | - | 2376356..2377729 (+) | 1374 | WP_145375984.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17460.09 Da Isoelectric Point: 4.9328
>NTDB_id=305305 DWB96_RS11465 WP_145375965.1 2367077..2367547(-) (ssbA) [Staphylococcus caprae strain 26D]
MINRVVLVGRLTKDPEFRTTPSGVEVANFTLAINRNFTNAQGERESDFINVIVFRKQAQNVNNYLSKGKLAGVDGRMQSR
SYENQEGRRVFVTEVVADSVQFLEPKDNNNGQQDTYQQQANQQRGQSQSSNDKAQSSNPFANANGPIDISDDDLPF
MINRVVLVGRLTKDPEFRTTPSGVEVANFTLAINRNFTNAQGERESDFINVIVFRKQAQNVNNYLSKGKLAGVDGRMQSR
SYENQEGRRVFVTEVVADSVQFLEPKDNNNGQQDTYQQQANQQRGQSQSSNDKAQSSNPFANANGPIDISDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=305305 DWB96_RS11465 WP_145375965.1 2367077..2367547(-) (ssbA) [Staphylococcus caprae strain 26D]
ATGATTAACAGAGTTGTATTGGTGGGTCGTTTAACGAAAGATCCAGAATTCAGAACTACGCCAAGTGGTGTAGAAGTTGC
TAACTTCACATTAGCAATAAATAGAAATTTTACTAACGCACAAGGCGAACGTGAATCAGACTTTATTAACGTCATTGTAT
TTAGAAAGCAAGCGCAGAATGTAAATAACTATTTGAGTAAAGGTAAGTTAGCAGGCGTTGATGGACGTATGCAATCGCGA
AGTTACGAAAATCAAGAAGGTAGACGTGTATTCGTTACTGAGGTTGTTGCTGATAGCGTTCAGTTTCTAGAACCAAAGGA
TAATAATAACGGTCAACAAGATACTTATCAGCAGCAAGCAAATCAACAAAGAGGACAGTCGCAATCATCTAATGATAAAG
CACAAAGTAGTAATCCTTTTGCAAATGCCAATGGACCGATTGATATCTCTGATGATGATTTACCTTTCTAA
ATGATTAACAGAGTTGTATTGGTGGGTCGTTTAACGAAAGATCCAGAATTCAGAACTACGCCAAGTGGTGTAGAAGTTGC
TAACTTCACATTAGCAATAAATAGAAATTTTACTAACGCACAAGGCGAACGTGAATCAGACTTTATTAACGTCATTGTAT
TTAGAAAGCAAGCGCAGAATGTAAATAACTATTTGAGTAAAGGTAAGTTAGCAGGCGTTGATGGACGTATGCAATCGCGA
AGTTACGAAAATCAAGAAGGTAGACGTGTATTCGTTACTGAGGTTGTTGCTGATAGCGTTCAGTTTCTAGAACCAAAGGA
TAATAATAACGGTCAACAAGATACTTATCAGCAGCAAGCAAATCAACAAAGAGGACAGTCGCAATCATCTAATGATAAAG
CACAAAGTAGTAATCCTTTTGCAAATGCCAATGGACCGATTGATATCTCTGATGATGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.062 |
100 |
0.647 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
67.949 |
0.391 |
| ssb | Vibrio cholerae strain A1552 |
32.955 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |