Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | DV131_RS03035 | Genome accession | NZ_CP031246 |
| Coordinates | 550046..550186 (-) | Length | 46 a.a. |
| NCBI ID | WP_000799697.1 | Uniprot ID | Q9X9B5 |
| Organism | Streptococcus pneumoniae strain M26368 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 545046..555186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DV131_RS03005 | - | 545399..545941 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| DV131_RS03020 | - | 546302..547699 (+) | 1398 | WP_114865846.1 | ISNCY-like element IS1202 family transposase | - |
| DV131_RS12055 | - | 547772..547897 (+) | 126 | WP_001258159.1 | hypothetical protein | - |
| DV131_RS03025 | comE | 547959..548711 (-) | 753 | WP_000866075.1 | competence system response regulator transcription factor ComE | Regulator |
| DV131_RS03030 | comD/comD1 | 548708..550033 (-) | 1326 | WP_025169508.1 | competence system sensor histidine kinase ComD | Regulator |
| DV131_RS03035 | comC | 550046..550186 (-) | 141 | WP_000799697.1 | competence-stimulating peptide ComC | Regulator |
| DV131_RS03045 | rlmH | 550468..550947 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| DV131_RS03050 | htrA | 551130..552311 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| DV131_RS03055 | spo0J | 552369..553127 (+) | 759 | WP_000410381.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| DV131_RS03060 | dnaA | 553340..554701 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5673.62 Da Isoelectric Point: 11.0565
>NTDB_id=304700 DV131_RS03035 WP_000799697.1 550046..550186(-) (comC) [Streptococcus pneumoniae strain M26368]
MKNTVKLEQFVALKEKDLQNIQGGEMRKMNEKSFNIFNFFNFFRRR
MKNTVKLEQFVALKEKDLQNIQGGEMRKMNEKSFNIFNFFNFFRRR
Nucleotide
Download Length: 141 bp
>NTDB_id=304700 DV131_RS03035 WP_000799697.1 550046..550186(-) (comC) [Streptococcus pneumoniae strain M26368]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATGAG
GAAAATGAATGAAAAGTCCTTTAATATCTTTAATTTCTTTAATTTCTTTAGAAGAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATGAG
GAAAATGAATGAAAAGTCCTTTAATATCTTTAATTTCTTTAATTTCTTTAGAAGAAGATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
67.391 |
100 |
0.674 |
| comC/comC2 | Streptococcus pneumoniae A66 |
92.593 |
58.696 |
0.543 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
92.593 |
58.696 |
0.543 |
| comC/comC1 | Streptococcus pneumoniae R6 |
92.593 |
58.696 |
0.543 |
| comC/comC1 | Streptococcus pneumoniae G54 |
92.593 |
58.696 |
0.543 |
| comC/comC1 | Streptococcus pneumoniae D39 |
92.593 |
58.696 |
0.543 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
92.593 |
58.696 |
0.543 |
| comC | Streptococcus mitis SK321 |
92.593 |
58.696 |
0.543 |