Detailed information NTG0300451

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: DQ228_RS09165
• Genome accession: NZ_CP030250
• Coordinates: 1779123..1779551 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain CS20
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1774123..1784551

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DQ228_RS09120	-	1774259..1774702 (-)	444	WP_011681680.1	hypothetical protein	-
DQ228_RS09125	-	1774776..1775114 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
DQ228_RS09130	-	1775158..1775433 (-)	276	WP_011681681.1	hypothetical protein	-
DQ228_RS09135	-	1775445..1775643 (-)	199	Protein_1785	helix-turn-helix transcriptional regulator	-
DQ228_RS09140	-	1775892..1777085 (-)	1194	WP_014608740.1	acetate kinase	-
DQ228_RS09145	comYH	1777141..1778097 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
DQ228_RS09150	comGG	1778142..1778459 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
DQ228_RS09155	comYF	1778437..1778874 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
DQ228_RS09160	comGE	1778858..1779151 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
DQ228_RS09165	comYD	1779123..1779551 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
DQ228_RS09170	comYC	1779511..1779837 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
DQ228_RS09175	comYB	1779834..1780934 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
DQ228_RS09180	comGA/cglA/cilD	1780816..1781757 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
DQ228_RS09185	-	1781838..1782200 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=300451 DQ228_RS09165 WP_011226626.1 1779123..1779551(-) (comYD) [Streptococcus thermophilus strain CS20]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=300451 DQ228_RS09165 WP_011226626.1 1779123..1779551(-) (comYD) [Streptococcus thermophilus strain CS20]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGTTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCGAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38