Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | DQ228_RS01340 | Genome accession | NZ_CP030250 |
| Coordinates | 247280..247489 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS20 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 242280..252489
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQ228_RS01310 | - | 242718..243227 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| DQ228_RS01315 | - | 243539..244096 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| DQ228_RS01320 | - | 244099..244749 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| DQ228_RS01325 | comR | 244944..245843 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| DQ228_RS01330 | - | 246081..246512 (+) | 432 | Protein_236 | cysteine peptidase family C39 domain-containing protein | - |
| DQ228_RS01335 | - | 246542..247111 (+) | 570 | Protein_237 | ABC transporter transmembrane domain-containing protein | - |
| DQ228_RS01340 | comA | 247280..247489 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| DQ228_RS01345 | - | 247544..248112 (+) | 569 | Protein_239 | ATP-binding cassette domain-containing protein | - |
| DQ228_RS01350 | - | 248220..248552 (+) | 333 | WP_237788614.1 | DUF805 domain-containing protein | - |
| DQ228_RS01355 | - | 248604..248861 (-) | 258 | WP_237788615.1 | hypothetical protein | - |
| DQ228_RS01360 | - | 249102..249404 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| DQ228_RS01365 | - | 249628..249999 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| DQ228_RS01370 | - | 250405..250920 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| DQ228_RS01375 | - | 250945..251247 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| DQ228_RS01380 | - | 251259..251570 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=300409 DQ228_RS01340 WP_002946147.1 247280..247489(+) (comA) [Streptococcus thermophilus strain CS20]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=300409 DQ228_RS01340 WP_002946147.1 247280..247489(+) (comA) [Streptococcus thermophilus strain CS20]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |