Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PPRO_RS02195 | Genome accession | NC_008609 |
| Coordinates | 472424..472855 (-) | Length | 143 a.a. |
| NCBI ID | WP_011734395.1 | Uniprot ID | A1AL61 |
| Organism | Pelobacter propionicus DSM 2379 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 442849..484652 | 472424..472855 | within | 0 |
Gene organization within MGE regions
Location: 442849..484652
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPRO_RS02065 (Ppro_0423) | - | 443534..445138 (+) | 1605 | WP_011734371.1 | HEAT repeat domain-containing protein | - |
| PPRO_RS02070 (Ppro_0424) | - | 445074..446522 (+) | 1449 | WP_083761166.1 | HD-GYP domain-containing protein | - |
| PPRO_RS02075 (Ppro_0425) | - | 446488..447081 (-) | 594 | WP_011734372.1 | HEAT repeat domain-containing protein | - |
| PPRO_RS02080 (Ppro_0426) | mtgA | 447258..448205 (+) | 948 | WP_011734373.1 | monofunctional biosynthetic peptidoglycan transglycosylase | - |
| PPRO_RS02085 (Ppro_0427) | rlmN | 448289..449332 (+) | 1044 | WP_011734374.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| PPRO_RS02090 (Ppro_0428) | - | 449372..449902 (+) | 531 | WP_011734375.1 | V4R domain-containing protein | - |
| PPRO_RS19245 (Ppro_0429) | - | 449899..451194 (+) | 1296 | WP_011734376.1 | diguanylate cyclase domain-containing protein | - |
| PPRO_RS02100 (Ppro_0430) | - | 451274..452638 (-) | 1365 | WP_011734377.1 | DEAD/DEAH box helicase | - |
| PPRO_RS02105 (Ppro_0431) | mtnP | 453145..454008 (+) | 864 | WP_011734378.1 | S-methyl-5'-thioadenosine phosphorylase | - |
| PPRO_RS02110 (Ppro_0432) | - | 454040..454957 (+) | 918 | WP_011734379.1 | PfkB family carbohydrate kinase | - |
| PPRO_RS02115 (Ppro_0433) | - | 455050..455814 (+) | 765 | WP_011734380.1 | lipopolysaccharide assembly protein LapB | - |
| PPRO_RS02120 (Ppro_0434) | - | 455826..456695 (+) | 870 | WP_011734381.1 | RodZ domain-containing protein | - |
| PPRO_RS02125 (Ppro_0435) | - | 456909..457283 (+) | 375 | WP_011734382.1 | sigma-54 dependent transcriptional regulator | - |
| PPRO_RS02130 (Ppro_0436) | - | 457307..457762 (+) | 456 | WP_011734383.1 | universal stress protein | - |
| PPRO_RS02135 (Ppro_0437) | - | 457812..459008 (+) | 1197 | WP_041532479.1 | sensor histidine kinase | - |
| PPRO_RS02140 (Ppro_0438) | - | 459203..459601 (+) | 399 | WP_011734385.1 | response regulator | - |
| PPRO_RS02145 (Ppro_0439) | - | 459605..461203 (+) | 1599 | WP_011734386.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| PPRO_RS02150 (Ppro_0440) | - | 461283..462416 (+) | 1134 | WP_011734387.1 | 3'-5' exoribonuclease YhaM family protein | - |
| PPRO_RS02155 (Ppro_0441) | - | 462505..463758 (-) | 1254 | WP_011734388.1 | outer membrane beta-barrel domain-containing protein | - |
| PPRO_RS02160 (Ppro_0442) | hemB | 464035..465012 (+) | 978 | WP_011734389.1 | porphobilinogen synthase | - |
| PPRO_RS02165 (Ppro_0443) | - | 465018..465458 (-) | 441 | WP_011734390.1 | hypothetical protein | - |
| PPRO_RS02170 (Ppro_0444) | - | 465571..467541 (-) | 1971 | WP_011734391.1 | hypothetical protein | - |
| PPRO_RS21795 (Ppro_0445) | - | 467544..468362 (-) | 819 | Protein_447 | AAA family ATPase | - |
| PPRO_RS02180 (Ppro_0446) | - | 468395..469003 (-) | 609 | WP_011734392.1 | hypothetical protein | - |
| PPRO_RS02185 (Ppro_0447) | - | 469094..470908 (-) | 1815 | WP_011734393.1 | ABC transporter ATP-binding protein | - |
| PPRO_RS02190 (Ppro_0448) | - | 471134..471934 (-) | 801 | WP_011734394.1 | PilZ domain-containing protein | - |
| PPRO_RS02195 (Ppro_0449) | ssb | 472424..472855 (-) | 432 | WP_011734395.1 | single-stranded DNA-binding protein | Machinery gene |
| PPRO_RS21145 | - | 473139..473429 (-) | 291 | WP_049759618.1 | hypothetical protein | - |
| PPRO_RS19255 (Ppro_0450) | - | 473428..473820 (+) | 393 | WP_049759619.1 | hypothetical protein | - |
| PPRO_RS02205 (Ppro_0451) | - | 474033..475052 (+) | 1020 | WP_011734397.1 | triphosphoribosyl-dephospho-CoA synthase | - |
| PPRO_RS02210 (Ppro_0452) | icd | 475085..476497 (+) | 1413 | WP_011734398.1 | NADP-dependent isocitrate dehydrogenase | - |
| PPRO_RS02215 (Ppro_0453) | - | 476581..477432 (-) | 852 | WP_011734399.1 | deoxyribonuclease IV | - |
| PPRO_RS02220 (Ppro_0454) | glp | 477479..478693 (-) | 1215 | WP_011734400.1 | gephyrin-like molybdotransferase Glp | - |
| PPRO_RS02225 (Ppro_0455) | - | 478870..481683 (+) | 2814 | WP_011734401.1 | GPMC system transcriptional regulator | - |
| PPRO_RS02230 (Ppro_0456) | - | 481974..482276 (+) | 303 | WP_198138316.1 | hypothetical protein | - |
| PPRO_RS02235 (Ppro_0457) | - | 482522..482956 (+) | 435 | WP_198138261.1 | hypothetical protein | - |
| PPRO_RS02240 (Ppro_0458) | - | 483111..484565 (+) | 1455 | WP_011734404.1 | IS481 family transposase | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 16068.96 Da Isoelectric Point: 5.9674
>NTDB_id=27003 PPRO_RS02195 WP_011734395.1 472424..472855(-) (ssb) [Pelobacter propionicus DSM 2379]
MASLNKVMLIGNLGRDPEVRYTASGQAVASFNLATTEKFKNRNGEWEERTEWHRVTLWARLAEIAGEYLSKGKTVYIEGR
LQTREYEKDGIKRYTTEIVGEKMQMLSPKGERRSSGDSYSPAPAGTSGGGYEPPPFQDDDIPF
MASLNKVMLIGNLGRDPEVRYTASGQAVASFNLATTEKFKNRNGEWEERTEWHRVTLWARLAEIAGEYLSKGKTVYIEGR
LQTREYEKDGIKRYTTEIVGEKMQMLSPKGERRSSGDSYSPAPAGTSGGGYEPPPFQDDDIPF
Nucleotide
Download Length: 432 bp
>NTDB_id=27003 PPRO_RS02195 WP_011734395.1 472424..472855(-) (ssb) [Pelobacter propionicus DSM 2379]
ATGGCCAGTCTCAACAAAGTAATGCTGATCGGAAATCTGGGCAGGGACCCGGAGGTGCGCTACACCGCATCCGGTCAGGC
CGTTGCCAGCTTCAACCTGGCGACCACCGAAAAATTCAAGAACAGGAACGGGGAATGGGAGGAGCGCACTGAATGGCACC
GGGTGACCCTCTGGGCCCGTCTGGCCGAGATCGCCGGGGAGTACCTCTCCAAGGGCAAAACCGTCTACATCGAGGGACGC
CTACAGACCAGGGAATACGAGAAGGACGGTATCAAGCGCTATACCACCGAGATCGTGGGAGAAAAGATGCAGATGCTCTC
CCCCAAGGGTGAGCGCCGCAGCAGTGGTGATTCCTACTCCCCCGCACCGGCGGGCACCAGTGGCGGCGGCTATGAACCGC
CCCCCTTCCAGGATGACGACATTCCGTTCTGA
ATGGCCAGTCTCAACAAAGTAATGCTGATCGGAAATCTGGGCAGGGACCCGGAGGTGCGCTACACCGCATCCGGTCAGGC
CGTTGCCAGCTTCAACCTGGCGACCACCGAAAAATTCAAGAACAGGAACGGGGAATGGGAGGAGCGCACTGAATGGCACC
GGGTGACCCTCTGGGCCCGTCTGGCCGAGATCGCCGGGGAGTACCTCTCCAAGGGCAAAACCGTCTACATCGAGGGACGC
CTACAGACCAGGGAATACGAGAAGGACGGTATCAAGCGCTATACCACCGAGATCGTGGGAGAAAAGATGCAGATGCTCTC
CCCCAAGGGTGAGCGCCGCAGCAGTGGTGATTCCTACTCCCCCGCACCGGCGGGCACCAGTGGCGGCGGCTATGAACCGC
CCCCCTTCCAGGATGACGACATTCCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
45.763 |
100 |
0.566 |
| ssb | Neisseria gonorrhoeae MS11 |
44.509 |
100 |
0.538 |
| ssb | Glaesserella parasuis strain SC1401 |
39.444 |
100 |
0.496 |
| ssb | Neisseria meningitidis MC58 |
57.273 |
76.923 |
0.441 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
33.523 |
100 |
0.413 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
32.164 |
100 |
0.385 |