Detailed information
Bioinformatically predicted
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | C0971_RS17135 | Genome accession | NZ_CP026143 |
| Coordinates | 3363665..3364042 (-) | Length | 125 a.a. |
| NCBI ID | WP_003346745.1 | Uniprot ID | I3EBG5 |
| Organism | Bacillus methanolicus strain DFS2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3331870..3371630 | 3363665..3364042 | within | 0 |
Gene organization within MGE regions
Location: 3331870..3371630
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C0971_RS16985 (C0971_17010) | - | 3331870..3332274 (-) | 405 | WP_283108201.1 | IS3 family transposase | - |
| C0971_RS16990 (C0971_17015) | - | 3332460..3332912 (-) | 453 | WP_248892445.1 | IS3 family transposase | - |
| C0971_RS16995 (C0971_17020) | - | 3332897..3333250 (-) | 354 | WP_248892446.1 | transposase | - |
| C0971_RS17000 (C0971_17025) | - | 3333332..3333523 (+) | 192 | WP_248892447.1 | transposase | - |
| C0971_RS17005 (C0971_17030) | - | 3333677..3335704 (-) | 2028 | WP_248892448.1 | Ig-like domain-containing protein | - |
| C0971_RS17010 (C0971_17035) | - | 3335832..3336671 (-) | 840 | WP_248892449.1 | tyrosine-type recombinase/integrase | - |
| C0971_RS17015 (C0971_17040) | - | 3336683..3337021 (-) | 339 | WP_248892450.1 | tyrosine-type recombinase/integrase | - |
| C0971_RS17020 (C0971_17045) | istA | 3337053..3338243 (+) | 1191 | Protein_3310 | IS21 family transposase | - |
| C0971_RS17025 (C0971_17050) | istA | 3338373..3339929 (+) | 1557 | WP_248892451.1 | IS21 family transposase | - |
| C0971_RS17030 (C0971_17055) | istB | 3339926..3340696 (+) | 771 | WP_248892452.1 | IS21-like element helper ATPase IstB | - |
| C0971_RS17035 (C0971_17060) | istB | 3340821..3341573 (+) | 753 | WP_248892453.1 | IS21-like element helper ATPase IstB | - |
| C0971_RS17040 (C0971_17065) | - | 3341594..3342241 (-) | 648 | WP_248892454.1 | tyrosine-type recombinase/integrase | - |
| C0971_RS17045 (C0971_17070) | xerA | 3342263..3343096 (-) | 834 | WP_248892455.1 | site-specific tyrosine recombinase/integron integrase | - |
| C0971_RS17050 (C0971_17075) | - | 3343102..3343836 (-) | 735 | WP_248892456.1 | tyrosine-type recombinase/integrase | - |
| C0971_RS17055 | - | 3343821..3343994 (-) | 174 | WP_248892457.1 | hypothetical protein | - |
| C0971_RS17060 (C0971_17080) | - | 3344349..3344810 (+) | 462 | WP_248892458.1 | hypothetical protein | - |
| C0971_RS17065 (C0971_17085) | - | 3345154..3347844 (-) | 2691 | WP_248892459.1 | Ig-like domain-containing protein | - |
| C0971_RS17070 | - | 3348475..3349812 (-) | 1338 | WP_248892460.1 | hypothetical protein | - |
| C0971_RS17075 | - | 3349799..3350674 (-) | 876 | WP_248892461.1 | hypothetical protein | - |
| C0971_RS17080 (C0971_17095) | - | 3350711..3352096 (-) | 1386 | WP_248892462.1 | S41 family peptidase | - |
| C0971_RS17085 (C0971_17100) | - | 3352315..3353148 (+) | 834 | WP_248892463.1 | DUF4352 domain-containing protein | - |
| C0971_RS17090 (C0971_17105) | - | 3353401..3353847 (+) | 447 | WP_248892464.1 | C40 family peptidase | - |
| C0971_RS17095 (C0971_17110) | - | 3354149..3355771 (+) | 1623 | WP_248892465.1 | SWIM zinc finger family protein | - |
| C0971_RS17100 (C0971_17115) | - | 3355764..3358574 (+) | 2811 | WP_248892466.1 | DEAD/DEAH box helicase | - |
| C0971_RS17105 (C0971_17120) | - | 3358767..3359195 (-) | 429 | WP_248892467.1 | hypothetical protein | - |
| C0971_RS17110 (C0971_17130) | - | 3359449..3359649 (+) | 201 | WP_248892468.1 | transposase | - |
| C0971_RS17115 (C0971_17135) | - | 3359676..3360071 (-) | 396 | WP_283108202.1 | HXXEE domain-containing protein | - |
| C0971_RS17120 (C0971_17140) | - | 3360680..3362125 (-) | 1446 | WP_248892470.1 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase | - |
| C0971_RS17125 (C0971_17145) | - | 3362529..3363212 (-) | 684 | WP_248892471.1 | TerC family protein | - |
| C0971_RS17130 (C0971_17150) | - | 3363430..3363678 (-) | 249 | WP_248892472.1 | hypothetical protein | - |
| C0971_RS17135 (C0971_17155) | ssbB | 3363665..3364042 (-) | 378 | WP_003346745.1 | single-stranded DNA-binding protein | Machinery gene |
| C0971_RS17140 (C0971_17160) | - | 3364342..3364764 (+) | 423 | WP_248892473.1 | YwpF-like family protein | - |
| C0971_RS17145 (C0971_17165) | - | 3364859..3365086 (-) | 228 | WP_248892474.1 | hypothetical protein | - |
| C0971_RS17150 (C0971_17170) | - | 3365247..3365522 (-) | 276 | WP_003346753.1 | hypothetical protein | - |
| C0971_RS17155 (C0971_17175) | fabZ | 3365642..3366076 (-) | 435 | WP_003346755.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| C0971_RS17160 (C0971_17180) | - | 3366230..3366511 (-) | 282 | WP_248892475.1 | DNA-directed RNA polymerase subunit beta | - |
| C0971_RS17165 (C0971_17185) | - | 3366527..3367369 (-) | 843 | WP_248892476.1 | flagellar hook-basal body protein | - |
| C0971_RS17170 (C0971_17190) | - | 3367420..3368259 (-) | 840 | WP_248892477.1 | flagellar hook-basal body protein | - |
| C0971_RS17175 (C0971_17195) | - | 3368430..3369431 (-) | 1002 | WP_003346763.1 | rod shape-determining protein | - |
| C0971_RS17180 (C0971_17200) | spoIIID | 3369936..3370208 (-) | 273 | WP_003346764.1 | sporulation transcriptional regulator SpoIIID | - |
| C0971_RS17185 (C0971_17205) | - | 3370647..3371630 (-) | 984 | WP_248892478.1 | M23 family metallopeptidase | - |
Sequence
Protein
Download Length: 125 a.a. Molecular weight: 14189.12 Da Isoelectric Point: 9.4666
>NTDB_id=267539 C0971_RS17135 WP_003346745.1 3363665..3364042(-) (ssbB) [Bacillus methanolicus strain DFS2]
MINQVTLVGRLTRDPELRVTPDGTYVANIILAVNRNYRNQNGEIDTDFVQCTLWKKIAENTAQYCRKGSVLGITGRIQTR
NYENQEGKKVFVTEVVAEGVRFLSPKPSAEHTKQKEKEAFTVEKS
MINQVTLVGRLTRDPELRVTPDGTYVANIILAVNRNYRNQNGEIDTDFVQCTLWKKIAENTAQYCRKGSVLGITGRIQTR
NYENQEGKKVFVTEVVAEGVRFLSPKPSAEHTKQKEKEAFTVEKS
Nucleotide
Download Length: 378 bp
>NTDB_id=267539 C0971_RS17135 WP_003346745.1 3363665..3364042(-) (ssbB) [Bacillus methanolicus strain DFS2]
TTGATCAACCAAGTTACACTTGTCGGGAGGCTGACCAGAGACCCTGAATTAAGGGTTACACCCGATGGTACGTACGTAGC
CAATATCATTTTAGCGGTCAACCGCAACTATCGAAACCAGAATGGAGAAATCGACACTGACTTTGTCCAATGCACCCTCT
GGAAAAAAATCGCCGAGAACACGGCACAATATTGCAGGAAAGGTTCAGTGCTCGGAATCACAGGCAGAATCCAAACGAGA
AACTACGAAAATCAAGAAGGTAAAAAAGTTTTTGTAACAGAGGTCGTTGCTGAAGGTGTCCGATTCCTGAGCCCAAAGCC
TTCAGCTGAACATACCAAACAAAAAGAAAAGGAGGCTTTTACTGTTGAAAAATCATGA
TTGATCAACCAAGTTACACTTGTCGGGAGGCTGACCAGAGACCCTGAATTAAGGGTTACACCCGATGGTACGTACGTAGC
CAATATCATTTTAGCGGTCAACCGCAACTATCGAAACCAGAATGGAGAAATCGACACTGACTTTGTCCAATGCACCCTCT
GGAAAAAAATCGCCGAGAACACGGCACAATATTGCAGGAAAGGTTCAGTGCTCGGAATCACAGGCAGAATCCAAACGAGA
AACTACGAAAATCAAGAAGGTAAAAAAGTTTTTGTAACAGAGGTCGTTGCTGAAGGTGTCCGATTCCTGAGCCCAAAGCC
TTCAGCTGAACATACCAAACAAAAAGAAAAGGAGGCTTTTACTGTTGAAAAATCATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
63.551 |
85.6 |
0.544 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
84.8 |
0.512 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.45 |
88.8 |
0.448 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.991 |
85.6 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.991 |
85.6 |
0.368 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.453 |
84.8 |
0.36 |