Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   C2H93_RS10430 Genome accession   NZ_CP026036
Coordinates   2061337..2061711 (-) Length   124 a.a.
NCBI ID   WP_064671036.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK5_16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2056337..2066711
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H93_RS10390 (C2H93_10405) yqhG 2056668..2057462 (+) 795 WP_032726154.1 YqhG family protein -
  C2H93_RS10395 (C2H93_10415) sinI 2057646..2057819 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H93_RS10400 (C2H93_10420) sinR 2057853..2058188 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H93_RS10405 (C2H93_10425) tasA 2058280..2059065 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H93_RS10410 (C2H93_10430) sipW 2059130..2059702 (-) 573 WP_249852808.1 signal peptidase I SipW -
  C2H93_RS10415 (C2H93_10435) tapA 2059686..2060447 (-) 762 WP_249852183.1 amyloid fiber anchoring/assembly protein TapA -
  C2H93_RS10420 (C2H93_10440) yqzG 2060718..2061044 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H93_RS10425 (C2H93_10445) spoIIT 2061086..2061265 (-) 180 WP_014480252.1 YqzE family protein -
  C2H93_RS10430 (C2H93_10450) comGG 2061337..2061711 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  C2H93_RS10435 (C2H93_10455) comGF 2061712..2062095 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C2H93_RS10440 (C2H93_10460) comGE 2062121..2062468 (-) 348 WP_249852184.1 ComG operon protein 5 Machinery gene
  C2H93_RS10445 (C2H93_10465) comGD 2062452..2062883 (-) 432 WP_249852185.1 competence type IV pilus minor pilin ComGD Machinery gene
  C2H93_RS10450 (C2H93_10470) comGC 2062873..2063169 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C2H93_RS10455 (C2H93_10475) comGB 2063183..2064220 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  C2H93_RS10460 (C2H93_10480) comGA 2064207..2065277 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  C2H93_RS10465 (C2H93_10485) - 2065488..2065685 (-) 198 WP_072173931.1 hypothetical protein -
  C2H93_RS10470 (C2H93_10490) corA 2065687..2066640 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14538.80 Da        Isoelectric Point: 9.7778

>NTDB_id=265618 C2H93_RS10430 WP_064671036.1 2061337..2061711(-) (comGG) [Bacillus subtilis strain PK5_16]
MYRTRGFIYPAVLFVSALVLLIVNFAAVQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEERKGQKGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=265618 C2H93_RS10430 WP_064671036.1 2061337..2061711(-) (comGG) [Bacillus subtilis strain PK5_16]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGTTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGAAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952


Multiple sequence alignment