Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C2H93_RS10395 Genome accession   NZ_CP026036
Coordinates   2057646..2057819 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK5_16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2052646..2062819
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H93_RS10380 (C2H93_10395) gcvT 2053444..2054532 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  C2H93_RS10385 (C2H93_10400) yqhH 2054974..2056647 (+) 1674 WP_032726152.1 SNF2-related protein -
  C2H93_RS10390 (C2H93_10405) yqhG 2056668..2057462 (+) 795 WP_032726154.1 YqhG family protein -
  C2H93_RS10395 (C2H93_10415) sinI 2057646..2057819 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H93_RS10400 (C2H93_10420) sinR 2057853..2058188 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H93_RS10405 (C2H93_10425) tasA 2058280..2059065 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H93_RS10410 (C2H93_10430) sipW 2059130..2059702 (-) 573 WP_249852808.1 signal peptidase I SipW -
  C2H93_RS10415 (C2H93_10435) tapA 2059686..2060447 (-) 762 WP_249852183.1 amyloid fiber anchoring/assembly protein TapA -
  C2H93_RS10420 (C2H93_10440) yqzG 2060718..2061044 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H93_RS10425 (C2H93_10445) spoIIT 2061086..2061265 (-) 180 WP_014480252.1 YqzE family protein -
  C2H93_RS10430 (C2H93_10450) comGG 2061337..2061711 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  C2H93_RS10435 (C2H93_10455) comGF 2061712..2062095 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C2H93_RS10440 (C2H93_10460) comGE 2062121..2062468 (-) 348 WP_249852184.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=265616 C2H93_RS10395 WP_014477323.1 2057646..2057819(+) (sinI) [Bacillus subtilis strain PK5_16]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=265616 C2H93_RS10395 WP_014477323.1 2057646..2057819(+) (sinI) [Bacillus subtilis strain PK5_16]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment