Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLG50_RS10710 Genome accession   NZ_CP025500
Coordinates   2170350..2170634 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain G50     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2165350..2175634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLG50_RS10680 (LLG50_10680) - 2165791..2166168 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLG50_RS10685 (LLG50_10685) - 2166373..2167239 (+) 867 WP_103055167.1 RluA family pseudouridine synthase -
  LLG50_RS10690 (LLG50_10690) - 2167277..2168086 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLG50_RS10695 (LLG50_10695) - 2168079..2168816 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLG50_RS10700 (LLG50_10700) - 2168993..2169835 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LLG50_RS10705 (LLG50_10705) - 2169832..2170269 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LLG50_RS10710 (LLG50_10710) comGG 2170350..2170634 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLG50_RS10715 (LLG50_10715) comGF 2170673..2171119 (-) 447 WP_058203710.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLG50_RS10720 (LLG50_10720) comGE 2171082..2171378 (-) 297 WP_033900709.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLG50_RS10725 (LLG50_10725) comGD 2171350..2171781 (-) 432 WP_103055168.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLG50_RS10730 (LLG50_10730) comGC 2171741..2172124 (-) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  LLG50_RS10735 (LLG50_10735) comGB 2172138..2173211 (-) 1074 WP_080735950.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLG50_RS10740 (LLG50_10740) comGA 2173105..2174043 (-) 939 WP_033900707.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=262112 LLG50_RS10710 WP_017865155.1 2170350..2170634(-) (comGG) [Lactococcus lactis subsp. lactis strain G50]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=262112 LLG50_RS10710 WP_017865155.1 2170350..2170634(-) (comGG) [Lactococcus lactis subsp. lactis strain G50]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596


Multiple sequence alignment