Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | CR921_RS10175 | Genome accession | NZ_CP025399 |
| Coordinates | 262397..262606 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain GABA | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257397..267606
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CR921_RS01440 | - | 257836..258345 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| CR921_RS01445 | - | 258656..259213 (+) | 558 | WP_011680718.1 | ECF transporter S component | - |
| CR921_RS01450 | - | 259216..259866 (+) | 651 | WP_011680719.1 | phosphatase PAP2 family protein | - |
| CR921_RS01455 | comR | 260061..260960 (+) | 900 | WP_011680720.1 | helix-turn-helix domain-containing protein | Regulator |
| CR921_RS09875 | - | 261198..261779 (+) | 582 | Protein_234 | cysteine peptidase family C39 domain-containing protein | - |
| CR921_RS09880 | comA | 261764..262054 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| CR921_RS10175 | comA | 262397..262606 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| CR921_RS01475 | - | 262661..263229 (+) | 569 | Protein_237 | ATP-binding cassette domain-containing protein | - |
| CR921_RS10180 | - | 263460..263648 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| CR921_RS10185 | - | 263616..263900 (-) | 285 | WP_232557103.1 | hypothetical protein | - |
| CR921_RS10190 | - | 264141..264443 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| CR921_RS10195 | - | 264667..265038 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| CR921_RS01490 | - | 265444..265959 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| CR921_RS01495 | - | 265984..266286 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| CR921_RS01500 | - | 266298..266609 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=260963 CR921_RS10175 WP_002946147.1 262397..262606(+) (comA) [Streptococcus thermophilus strain GABA]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=260963 CR921_RS10175 WP_002946147.1 262397..262606(+) (comA) [Streptococcus thermophilus strain GABA]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |