Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FORC62_RS06085 | Genome accession | NZ_CP022582 |
| Coordinates | 1173953..1174423 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934768.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FORC_062 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1163139..1207198 | 1173953..1174423 | within | 0 |
Gene organization within MGE regions
Location: 1163139..1207198
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC62_RS06005 (FORC62_1091) | - | 1163139..1164524 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| FORC62_RS06010 (FORC62_1092) | - | 1164731..1165411 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| FORC62_RS06015 (FORC62_1093) | - | 1165443..1166168 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| FORC62_RS06020 (FORC62_1094) | - | 1166196..1166871 (-) | 676 | Protein_1131 | ImmA/IrrE family metallo-endopeptidase | - |
| FORC62_RS06025 (FORC62_1095) | - | 1166888..1167220 (-) | 333 | WP_063456459.1 | helix-turn-helix domain-containing protein | - |
| FORC62_RS06030 (FORC62_1096) | - | 1167483..1167677 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| FORC62_RS06035 (FORC62_1097) | - | 1167677..1168441 (+) | 765 | WP_001002760.1 | phage antirepressor Ant | - |
| FORC62_RS06040 (FORC62_1098) | - | 1168458..1168652 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| FORC62_RS06045 (FORC62_1100) | - | 1168856..1169086 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| FORC62_RS15430 | - | 1169145..1169273 (+) | 129 | WP_001559112.1 | hypothetical protein | - |
| FORC62_RS06050 (FORC62_1101) | - | 1169266..1169433 (+) | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| FORC62_RS06055 (FORC62_1102) | - | 1169434..1169754 (+) | 321 | WP_000219666.1 | hypothetical protein | - |
| FORC62_RS06060 (FORC62_1103) | - | 1169848..1170108 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| FORC62_RS06065 (FORC62_1104) | - | 1170117..1170380 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| FORC62_RS06070 (FORC62_1105) | - | 1170389..1172332 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| FORC62_RS06075 (FORC62_1106) | - | 1172334..1173254 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| FORC62_RS06080 (FORC62_1107) | - | 1173335..1173952 (+) | 618 | WP_071890040.1 | MBL fold metallo-hydrolase | - |
| FORC62_RS06085 (FORC62_1108) | ssbA | 1173953..1174423 (+) | 471 | WP_000934768.1 | single-stranded DNA-binding protein | Machinery gene |
| FORC62_RS06090 (FORC62_1109) | - | 1174453..1175340 (+) | 888 | WP_044422683.1 | DnaD domain protein | - |
| FORC62_RS06095 (FORC62_1110) | - | 1175347..1175565 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| FORC62_RS06100 (FORC62_1111) | - | 1175574..1175978 (+) | 405 | WP_000401973.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FORC62_RS06105 (FORC62_1112) | - | 1175991..1176368 (+) | 378 | WP_031875644.1 | SA1788 family PVL leukocidin-associated protein | - |
| FORC62_RS06110 (FORC62_1113) | - | 1176369..1176617 (+) | 249 | WP_001126832.1 | phi PVL orf 51-like protein | - |
| FORC62_RS06115 (FORC62_1114) | - | 1176630..1177031 (+) | 402 | WP_015978402.1 | hypothetical protein | - |
| FORC62_RS06120 (FORC62_1115) | - | 1177028..1177312 (+) | 285 | WP_001105618.1 | hypothetical protein | - |
| FORC62_RS06125 (FORC62_1116) | - | 1177305..1177553 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| FORC62_RS06130 (FORC62_1117) | - | 1177546..1178082 (+) | 537 | WP_031789556.1 | dUTPase | - |
| FORC62_RS06135 (FORC62_1118) | - | 1178119..1178292 (+) | 174 | WP_001209219.1 | hypothetical protein | - |
| FORC62_RS06140 (FORC62_1119) | - | 1178309..1178515 (+) | 207 | WP_000195779.1 | DUF1381 domain-containing protein | - |
| FORC62_RS06145 (FORC62_1120) | - | 1178512..1178706 (+) | 195 | WP_000132920.1 | hypothetical protein | - |
| FORC62_RS06150 (FORC62_1121) | - | 1178703..1178906 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| FORC62_RS06155 (FORC62_1122) | - | 1178899..1179135 (+) | 237 | WP_000608273.1 | hypothetical protein | - |
| FORC62_RS06160 (FORC62_1123) | - | 1179125..1179511 (+) | 387 | WP_010924755.1 | hypothetical protein | - |
| FORC62_RS06165 (FORC62_1124) | - | 1179511..1179684 (+) | 174 | WP_000595245.1 | transcriptional activator RinB | - |
| FORC62_RS06170 (FORC62_1125) | - | 1179685..1179831 (+) | 147 | WP_000990001.1 | hypothetical protein | - |
| FORC62_RS06175 (FORC62_1126) | - | 1179855..1180277 (+) | 423 | WP_000162702.1 | RinA family phage transcriptional activator | - |
| FORC62_RS06180 (FORC62_1127) | - | 1180605..1181099 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| FORC62_RS06185 (FORC62_1128) | - | 1181092..1182300 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| FORC62_RS06190 (FORC62_1129) | - | 1182314..1183732 (+) | 1419 | WP_225305868.1 | phage portal protein | - |
| FORC62_RS06195 (FORC62_1130) | - | 1183671..1184651 (+) | 981 | WP_001795666.1 | phage head morphogenesis protein | - |
| FORC62_RS06200 (FORC62_1131) | - | 1184749..1185345 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| FORC62_RS06205 (FORC62_1132) | - | 1185366..1186190 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| FORC62_RS06210 (FORC62_1133) | - | 1186207..1186533 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| FORC62_RS06215 (FORC62_1134) | - | 1186533..1186847 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| FORC62_RS06220 (FORC62_1135) | - | 1186840..1187175 (+) | 336 | WP_000482986.1 | phage head closure protein | - |
| FORC62_RS06225 (FORC62_1136) | - | 1187162..1187575 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FORC62_RS06230 (FORC62_1137) | - | 1187588..1188025 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| FORC62_RS06235 (FORC62_1138) | - | 1188012..1188572 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| FORC62_RS06240 (FORC62_1139) | - | 1188634..1189128 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| FORC62_RS06245 (FORC62_1140) | - | 1189149..1189490 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| FORC62_RS06250 (FORC62_1141) | - | 1189493..1192462 (+) | 2970 | WP_044425803.1 | terminase | - |
| FORC62_RS06255 (FORC62_1142) | - | 1192477..1193412 (+) | 936 | WP_000560196.1 | phage tail domain-containing protein | - |
| FORC62_RS06260 (FORC62_1143) | - | 1193423..1195309 (+) | 1887 | WP_044425805.1 | SGNH/GDSL hydrolase family protein | - |
| FORC62_RS06265 (FORC62_1144) | - | 1195322..1197220 (+) | 1899 | WP_063664751.1 | hypothetical protein | - |
| FORC62_RS06270 (FORC62_1145) | - | 1197220..1199043 (+) | 1824 | WP_114914767.1 | phage baseplate upper protein | - |
| FORC62_RS06275 (FORC62_1146) | - | 1199043..1199450 (+) | 408 | WP_044425645.1 | DUF2977 domain-containing protein | - |
| FORC62_RS06280 (FORC62_1147) | - | 1199425..1199598 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| FORC62_RS06285 (FORC62_1148) | - | 1199639..1199937 (+) | 299 | Protein_1185 | DUF2951 family protein | - |
| FORC62_RS06290 (FORC62_1150) | - | 1200430..1201050 (+) | 621 | WP_000355823.1 | AP2 domain-containing protein | - |
| FORC62_RS06295 (FORC62_1151) | - | 1201131..1202930 (+) | 1800 | Protein_1187 | glucosaminidase domain-containing protein | - |
| FORC62_RS06300 (FORC62_1152) | - | 1202943..1204115 (+) | 1173 | WP_044435510.1 | BppU family phage baseplate upper protein | - |
| FORC62_RS06305 (FORC62_1153) | - | 1204121..1204516 (+) | 396 | WP_044435513.1 | hypothetical protein | - |
| FORC62_RS06310 (FORC62_1154) | - | 1204572..1205009 (+) | 438 | WP_000354133.1 | phage holin | - |
| FORC62_RS06315 (FORC62_1155) | - | 1204990..1206435 (+) | 1446 | WP_069479479.1 | SH3 domain-containing protein | - |
| FORC62_RS06320 | - | 1206678..1206830 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| FORC62_RS06325 | - | 1206901..1207011 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| FORC62_RS06330 (FORC62_1156) | - | 1207013..1207198 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17747.64 Da Isoelectric Point: 4.9816
>NTDB_id=240981 FORC62_RS06085 WP_000934768.1 1173953..1174423(+) (ssbA) [Staphylococcus aureus strain FORC_062]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=240981 FORC62_RS06085 WP_000934768.1 1173953..1174423(+) (ssbA) [Staphylococcus aureus strain FORC_062]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |