Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | BSR25_RS08505 | Genome accession | NZ_CP020604 |
| Coordinates | 1680588..1680872 (-) | Length | 94 a.a. |
| NCBI ID | WP_010906314.1 | Uniprot ID | A0AAC9R304 |
| Organism | Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1670372..1724645 | 1680588..1680872 | within | 0 |
Gene organization within MGE regions
Location: 1670372..1724645
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSR25_RS08455 (BSR25_1671) | - | 1670372..1672189 (-) | 1818 | WP_010906306.1 | acyltransferase family protein | - |
| BSR25_RS08460 (BSR25_1672) | - | 1672291..1674522 (-) | 2232 | WP_003129980.1 | PBP1A family penicillin-binding protein | - |
| BSR25_RS08465 (BSR25_1674) | - | 1674831..1675466 (-) | 636 | WP_010906307.1 | DUF421 domain-containing protein | - |
| BSR25_RS08470 (BSR25_1675) | - | 1675483..1675914 (-) | 432 | WP_010906308.1 | DUF3290 domain-containing protein | - |
| BSR25_RS08475 (BSR25_1676) | - | 1676028..1676405 (-) | 378 | WP_003129983.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| BSR25_RS08480 (BSR25_1677) | - | 1676610..1677476 (+) | 867 | WP_010906309.1 | RluA family pseudouridine synthase | - |
| BSR25_RS08485 (BSR25_1678) | - | 1677515..1678324 (-) | 810 | WP_010906310.1 | metal ABC transporter permease | - |
| BSR25_RS08490 (BSR25_1679) | - | 1678317..1679054 (-) | 738 | WP_010906311.1 | metal ABC transporter ATP-binding protein | - |
| BSR25_RS08495 (BSR25_1680) | - | 1679231..1680073 (-) | 843 | WP_010906312.1 | metal ABC transporter substrate-binding protein | - |
| BSR25_RS08500 (BSR25_1681) | - | 1680070..1680507 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| BSR25_RS08505 (BSR25_1682) | comGG | 1680588..1680872 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BSR25_RS08510 (BSR25_1683) | comGF | 1680911..1681357 (-) | 447 | WP_031296844.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| BSR25_RS08515 | comGE | 1681320..1681616 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BSR25_RS08520 (BSR25_1685) | comGD | 1681588..1682004 (-) | 417 | WP_021216554.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| BSR25_RS08525 (BSR25_1686) | comGC | 1681979..1682248 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| BSR25_RS08530 (BSR25_1687) | - | 1682395..1682919 (-) | 525 | WP_014570795.1 | GNAT family N-acetyltransferase | - |
| BSR25_RS08535 (BSR25_1688) | - | 1682998..1683777 (-) | 780 | WP_058147788.1 | peptidoglycan amidohydrolase family protein | - |
| BSR25_RS08540 (BSR25_1689) | - | 1683777..1684076 (-) | 300 | WP_031559226.1 | phage holin | - |
| BSR25_RS08545 (BSR25_1690) | - | 1684089..1684439 (-) | 351 | WP_023349296.1 | hypothetical protein | - |
| BSR25_RS08550 (BSR25_1691) | - | 1684459..1686477 (-) | 2019 | WP_415880874.1 | DUF7013 family protein | - |
| BSR25_RS08555 (BSR25_1692) | - | 1686461..1686634 (-) | 174 | WP_086383510.1 | hypothetical protein | - |
| BSR25_RS08560 (BSR25_1693) | - | 1686634..1687755 (-) | 1122 | WP_086383554.1 | hypothetical protein | - |
| BSR25_RS08565 (BSR25_1694) | - | 1687772..1689565 (-) | 1794 | WP_086383652.1 | phage tail protein | - |
| BSR25_RS08570 (BSR25_1695) | - | 1689562..1691082 (-) | 1521 | WP_086383555.1 | distal tail protein Dit | - |
| BSR25_RS08575 (BSR25_1696) | - | 1691092..1693701 (-) | 2610 | WP_023349195.1 | hypothetical protein | - |
| BSR25_RS08580 (BSR25_1697) | - | 1693691..1694398 (-) | 708 | WP_014570560.1 | Gp15 family bacteriophage protein | - |
| BSR25_RS08585 (BSR25_1698) | - | 1694414..1694821 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| BSR25_RS08590 (BSR25_1699) | - | 1694878..1695354 (-) | 477 | WP_014570559.1 | phage tail tube protein | - |
| BSR25_RS08595 (BSR25_1700) | - | 1695365..1695799 (-) | 435 | WP_003131321.1 | phage tail terminator protein | - |
| BSR25_RS08600 (BSR25_1701) | - | 1695799..1696128 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| BSR25_RS08605 (BSR25_1702) | - | 1696125..1696469 (-) | 345 | WP_003131319.1 | putative minor capsid protein | - |
| BSR25_RS08610 (BSR25_1703) | - | 1696459..1696860 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| BSR25_RS08615 (BSR25_1704) | - | 1696934..1697170 (-) | 237 | WP_023349196.1 | Ig-like domain-containing protein | - |
| BSR25_RS08620 (BSR25_1705) | - | 1697199..1698116 (-) | 918 | WP_023349197.1 | phage capsid protein | - |
| BSR25_RS08625 (BSR25_1706) | - | 1698131..1699183 (-) | 1053 | WP_023349198.1 | XkdF-like putative serine protease domain-containing protein | - |
| BSR25_RS08630 (BSR25_1707) | - | 1699199..1700029 (-) | 831 | WP_023349199.1 | phage minor head protein | - |
| BSR25_RS08635 (BSR25_1708) | - | 1700022..1701551 (-) | 1530 | WP_023349200.1 | phage portal protein | - |
| BSR25_RS08640 (BSR25_1709) | terL | 1701564..1703015 (-) | 1452 | WP_023349201.1 | phage terminase large subunit | - |
| BSR25_RS08645 (BSR25_1710) | - | 1702996..1703493 (-) | 498 | WP_023349202.1 | hypothetical protein | - |
| BSR25_RS08650 (BSR25_1711) | - | 1703522..1704679 (-) | 1158 | WP_023349203.1 | DNA modification methylase | - |
| BSR25_RS08655 (BSR25_1712) | - | 1705156..1705578 (-) | 423 | WP_023349204.1 | RinA family protein | - |
| BSR25_RS08660 | - | 1705926..1706171 (-) | 246 | WP_023349207.1 | hypothetical protein | - |
| BSR25_RS08665 (BSR25_1714) | - | 1706193..1706690 (-) | 498 | WP_086383531.1 | hypothetical protein | - |
| BSR25_RS08670 (BSR25_1715) | - | 1706693..1707112 (-) | 420 | WP_086383533.1 | dUTP diphosphatase | - |
| BSR25_RS08675 (BSR25_1716) | - | 1707109..1707414 (-) | 306 | WP_023349170.1 | hypothetical protein | - |
| BSR25_RS08680 (BSR25_1717) | - | 1707411..1707914 (-) | 504 | WP_023349171.1 | DUF1642 domain-containing protein | - |
| BSR25_RS08685 (BSR25_1718) | - | 1707907..1708302 (-) | 396 | WP_058147723.1 | YopX family protein | - |
| BSR25_RS08695 (BSR25_1720) | - | 1708808..1709218 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| BSR25_RS08700 (BSR25_1721) | - | 1709231..1709473 (-) | 243 | WP_023349173.1 | L-rhamnose isomerase | - |
| BSR25_RS08705 (BSR25_1722) | - | 1709466..1710389 (-) | 924 | WP_023349174.1 | phage replisome organizer N-terminal domain-containing protein | - |
| BSR25_RS08710 (BSR25_1723) | - | 1710653..1711579 (-) | 927 | WP_014570813.1 | RecT family recombinase | - |
| BSR25_RS08715 (BSR25_1724) | - | 1711576..1712409 (-) | 834 | WP_023349175.1 | hypothetical protein | - |
| BSR25_RS08720 (BSR25_1725) | - | 1712512..1712760 (-) | 249 | WP_014570815.1 | hypothetical protein | - |
| BSR25_RS13510 (BSR25_1726) | - | 1712774..1712896 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| BSR25_RS08725 (BSR25_1727) | - | 1712893..1713075 (-) | 183 | WP_023349176.1 | hypothetical protein | - |
| BSR25_RS08730 (BSR25_1728) | - | 1713139..1713348 (-) | 210 | WP_023349177.1 | helix-turn-helix transcriptional regulator | - |
| BSR25_RS08735 (BSR25_1729) | - | 1713539..1713961 (+) | 423 | WP_023349178.1 | helix-turn-helix domain-containing protein | - |
| BSR25_RS08740 (BSR25_1730) | - | 1713972..1714556 (+) | 585 | WP_023349179.1 | hypothetical protein | - |
| BSR25_RS08745 (BSR25_1731) | - | 1714610..1715272 (+) | 663 | WP_023349180.1 | SHOCT domain-containing protein | - |
| BSR25_RS08750 (BSR25_1732) | - | 1715387..1716844 (+) | 1458 | WP_058147724.1 | recombinase family protein | - |
| BSR25_RS12990 | - | 1716841..1716981 (-) | 141 | WP_228777719.1 | hypothetical protein | - |
| BSR25_RS08755 (BSR25_1733) | comGB | 1716995..1718068 (-) | 1074 | WP_010906319.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| BSR25_RS08760 (BSR25_1734) | comGA | 1717962..1718900 (-) | 939 | WP_010906320.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| BSR25_RS08765 (BSR25_1735) | - | 1719020..1723936 (-) | 4917 | WP_031296849.1 | PolC-type DNA polymerase III | - |
| BSR25_RS08770 (BSR25_1736) | - | 1724109..1724645 (-) | 537 | WP_010906322.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=224922 BSR25_RS08505 WP_010906314.1 1680588..1680872(-) (comGG) [Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
Nucleotide
Download Length: 285 bp
>NTDB_id=224922 BSR25_RS08505 WP_010906314.1 1680588..1680872(-) (comGG) [Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
59.14 |
98.936 |
0.585 |