Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BSR25_RS08505 Genome accession   NZ_CP020604
Coordinates   1680588..1680872 (-) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   A0AAC9R304
Organism   Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1675588..1685872
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR25_RS08475 (BSR25_1676) - 1676028..1676405 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  BSR25_RS08480 (BSR25_1677) - 1676610..1677476 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  BSR25_RS08485 (BSR25_1678) - 1677515..1678324 (-) 810 WP_010906310.1 metal ABC transporter permease -
  BSR25_RS08490 (BSR25_1679) - 1678317..1679054 (-) 738 WP_010906311.1 metal ABC transporter ATP-binding protein -
  BSR25_RS08495 (BSR25_1680) - 1679231..1680073 (-) 843 WP_010906312.1 metal ABC transporter substrate-binding protein -
  BSR25_RS08500 (BSR25_1681) - 1680070..1680507 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  BSR25_RS08505 (BSR25_1682) comGG 1680588..1680872 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  BSR25_RS08510 (BSR25_1683) comGF 1680911..1681357 (-) 447 WP_031296844.1 competence type IV pilus minor pilin ComGF Machinery gene
  BSR25_RS08515 comGE 1681320..1681616 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  BSR25_RS08520 (BSR25_1685) comGD 1681588..1682004 (-) 417 WP_021216554.1 competence type IV pilus minor pilin ComGD Machinery gene
  BSR25_RS08525 (BSR25_1686) comGC 1681979..1682248 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  BSR25_RS08530 (BSR25_1687) - 1682395..1682919 (-) 525 WP_014570795.1 GNAT family N-acetyltransferase -
  BSR25_RS08535 (BSR25_1688) - 1682998..1683777 (-) 780 WP_058147788.1 peptidoglycan amidohydrolase family protein -
  BSR25_RS08540 (BSR25_1689) - 1683777..1684076 (-) 300 WP_031559226.1 phage holin -
  BSR25_RS08545 (BSR25_1690) - 1684089..1684439 (-) 351 WP_023349296.1 hypothetical protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=224922 BSR25_RS08505 WP_010906314.1 1680588..1680872(-) (comGG) [Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=224922 BSR25_RS08505 WP_010906314.1 1680588..1680872(-) (comGG) [Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585

Multiple sequence alignment