Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | BGL51_RS10370 | Genome accession | NZ_CP017064 |
| Coordinates | 278713..278922 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST3 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 273713..283922
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BGL51_RS01495 (BGL51_01540) | - | 274120..274659 (+) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| BGL51_RS01500 (BGL51_01545) | - | 274971..275528 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| BGL51_RS01505 (BGL51_01550) | - | 275531..276181 (+) | 651 | WP_095559229.1 | phosphatase PAP2 family protein | - |
| BGL51_RS01510 (BGL51_01555) | comR | 276376..277275 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| BGL51_RS01515 (BGL51_01565) | - | 277513..278691 (+) | 1179 | Protein_245 | ABC transporter transmembrane domain-containing protein | - |
| BGL51_RS10370 (BGL51_01575) | comA | 278713..278922 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| BGL51_RS01535 (BGL51_01580) | - | 278977..279545 (+) | 569 | Protein_247 | ATP-binding cassette domain-containing protein | - |
| BGL51_RS01540 (BGL51_01585) | - | 279672..279983 (+) | 312 | WP_095559231.1 | DUF805 domain-containing protein | - |
| BGL51_RS10375 | - | 279951..280235 (-) | 285 | WP_232085805.1 | hypothetical protein | - |
| BGL51_RS10380 (BGL51_01590) | - | 280475..281371 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| BGL51_RS01550 (BGL51_01595) | - | 281776..282291 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| BGL51_RS01555 (BGL51_01600) | - | 282316..282618 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| BGL51_RS01560 (BGL51_01605) | - | 282630..282941 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=195005 BGL51_RS10370 WP_002946147.1 278713..278922(+) (comA) [Streptococcus thermophilus strain ST3]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=195005 BGL51_RS10370 WP_002946147.1 278713..278922(+) (comA) [Streptococcus thermophilus strain ST3]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |