Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | BFM96_RS01395 | Genome accession | NZ_CP016953 |
| Coordinates | 297148..297642 (-) | Length | 164 a.a. |
| NCBI ID | WP_068989400.1 | Uniprot ID | A0A917ED94 |
| Organism | Streptococcus himalayensis strain HTS2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 268259..306814 | 297148..297642 | within | 0 |
Gene organization within MGE regions
Location: 268259..306814
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFM96_RS01220 | - | 268259..268645 (-) | 387 | WP_068989320.1 | PBECR2 nuclease fold domain-containing protein | - |
| BFM96_RS01225 | - | 268732..269472 (-) | 741 | Protein_230 | CHAP domain-containing protein | - |
| BFM96_RS11425 | - | 269444..269578 (-) | 135 | WP_262981928.1 | hypothetical protein | - |
| BFM96_RS01230 | - | 269592..269795 (-) | 204 | WP_068989329.1 | phage holin | - |
| BFM96_RS01235 | - | 269798..270181 (-) | 384 | WP_068989332.1 | hypothetical protein | - |
| BFM96_RS01240 | - | 270192..270458 (-) | 267 | WP_068989334.1 | hypothetical protein | - |
| BFM96_RS01245 | - | 270526..272622 (-) | 2097 | WP_068989337.1 | DUF859 domain-containing protein | - |
| BFM96_RS01250 | - | 272622..276458 (-) | 3837 | WP_068989340.1 | phage tail spike protein | - |
| BFM96_RS01255 | - | 276462..277961 (-) | 1500 | WP_068989342.1 | distal tail protein Dit | - |
| BFM96_RS01260 | - | 277958..281671 (-) | 3714 | WP_068989343.1 | tape measure protein | - |
| BFM96_RS01265 | - | 281692..282279 (-) | 588 | WP_068989345.1 | Gp15 family bacteriophage protein | - |
| BFM96_RS01270 | - | 282279..282647 (-) | 369 | WP_068989347.1 | hypothetical protein | - |
| BFM96_RS01275 | - | 282650..283108 (-) | 459 | WP_068989350.1 | phage tail tube protein | - |
| BFM96_RS01280 | - | 283113..283520 (-) | 408 | WP_068989353.1 | minor capsid protein | - |
| BFM96_RS01285 | - | 283520..283870 (-) | 351 | WP_068989354.1 | minor capsid protein | - |
| BFM96_RS01290 | - | 283870..284196 (-) | 327 | WP_068989357.1 | putative minor capsid protein | - |
| BFM96_RS01295 | - | 284186..284575 (-) | 390 | WP_068989360.1 | hypothetical protein | - |
| BFM96_RS01300 | - | 284612..284866 (-) | 255 | WP_068989363.1 | hypothetical protein | - |
| BFM96_RS01305 | - | 284882..285766 (-) | 885 | WP_068989366.1 | phage capsid protein | - |
| BFM96_RS01310 | - | 285784..286347 (-) | 564 | WP_068989369.1 | phage scaffolding protein | - |
| BFM96_RS01315 | - | 286505..286717 (-) | 213 | WP_068989372.1 | hypothetical protein | - |
| BFM96_RS01320 | - | 287082..288224 (-) | 1143 | Protein_250 | phage minor capsid protein | - |
| BFM96_RS01325 | - | 288227..288481 (-) | 255 | WP_373283960.1 | hypothetical protein | - |
| BFM96_RS01330 | - | 288465..290054 (-) | 1590 | WP_083201719.1 | phage portal protein | - |
| BFM96_RS01335 | - | 290066..291379 (-) | 1314 | WP_068989375.1 | PBSX family phage terminase large subunit | - |
| BFM96_RS01340 | - | 291366..291809 (-) | 444 | WP_068989377.1 | KGG domain-containing protein | - |
| BFM96_RS01345 | - | 292093..292488 (-) | 396 | WP_068989379.1 | hypothetical protein | - |
| BFM96_RS01350 | - | 292519..292917 (-) | 399 | WP_068989382.1 | hypothetical protein | - |
| BFM96_RS01355 | - | 292917..294014 (-) | 1098 | WP_068989385.1 | DUF4417 domain-containing protein | - |
| BFM96_RS01360 | - | 294082..294462 (-) | 381 | WP_068989388.1 | hypothetical protein | - |
| BFM96_RS01365 | - | 294596..294850 (-) | 255 | WP_068994096.1 | DUF1372 family protein | - |
| BFM96_RS01370 | - | 295096..295410 (-) | 315 | WP_068989392.1 | hypothetical protein | - |
| BFM96_RS01375 | - | 295461..296209 (-) | 749 | Protein_261 | DNA-methyltransferase | - |
| BFM96_RS01380 | - | 296221..296655 (-) | 435 | WP_068989394.1 | helix-turn-helix domain-containing protein | - |
| BFM96_RS01385 | - | 296652..296855 (-) | 204 | WP_068989396.1 | hypothetical protein | - |
| BFM96_RS01390 | - | 296857..297132 (-) | 276 | WP_068989398.1 | hypothetical protein | - |
| BFM96_RS01395 | ssbA | 297148..297642 (-) | 495 | WP_068989400.1 | single-stranded DNA-binding protein | Machinery gene |
| BFM96_RS01400 | - | 297636..297905 (-) | 270 | WP_068989403.1 | hypothetical protein | - |
| BFM96_RS11300 | - | 297898..297987 (-) | 90 | Protein_267 | phosphoribosyl-ATP diphosphatase | - |
| BFM96_RS01405 | - | 297981..299003 (-) | 1023 | WP_068989406.1 | DUF1351 domain-containing protein | - |
| BFM96_RS01410 | - | 299015..299722 (-) | 708 | WP_068989409.1 | ERF family protein | - |
| BFM96_RS11180 | - | 299731..299871 (-) | 141 | WP_188595261.1 | hypothetical protein | - |
| BFM96_RS01415 | - | 300134..300424 (-) | 291 | WP_068989411.1 | HTH domain-containing protein | - |
| BFM96_RS01420 | - | 300537..300872 (-) | 336 | WP_068989413.1 | hypothetical protein | - |
| BFM96_RS01425 | - | 301199..301459 (-) | 261 | WP_068994100.1 | hypothetical protein | - |
| BFM96_RS10735 | - | 301471..301599 (-) | 129 | WP_082815638.1 | ribbon-helix-helix domain-containing protein | - |
| BFM96_RS01430 | - | 301662..302192 (+) | 531 | WP_068989415.1 | hypothetical protein | - |
| BFM96_RS11185 | - | 302225..302365 (-) | 141 | WP_188595262.1 | hypothetical protein | - |
| BFM96_RS10740 | - | 302383..302511 (-) | 129 | WP_082815638.1 | ribbon-helix-helix domain-containing protein | - |
| BFM96_RS01435 | - | 302715..302870 (-) | 156 | WP_068994103.1 | DNA-binding protein | - |
| BFM96_RS01440 | - | 303697..304416 (+) | 720 | WP_068989418.1 | XRE family transcriptional regulator | - |
| BFM96_RS01445 | - | 304454..305419 (+) | 966 | WP_068989420.1 | DUF3644 domain-containing protein | - |
| BFM96_RS10745 | - | 305675..306814 (+) | 1140 | WP_083201722.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18345.12 Da Isoelectric Point: 5.1356
>NTDB_id=193991 BFM96_RS01395 WP_068989400.1 297148..297642(-) (ssbA) [Streptococcus himalayensis strain HTS2]
MLNNVVLVGRLTKDAELRYTPSNVAVATFTLAVNRPFKNEAGEREADFINCVIWRQAAENLANWAKKGSLIGITGSIQTR
NYENQQGQRVYVTEVLASHFQLLESRHQQNQGQQQGNYDNQGGNFQSGNNQGYNPSMNTNPQQGSFFQGQTTNPMDISDD
DLPF
MLNNVVLVGRLTKDAELRYTPSNVAVATFTLAVNRPFKNEAGEREADFINCVIWRQAAENLANWAKKGSLIGITGSIQTR
NYENQQGQRVYVTEVLASHFQLLESRHQQNQGQQQGNYDNQGGNFQSGNNQGYNPSMNTNPQQGSFFQGQTTNPMDISDD
DLPF
Nucleotide
Download Length: 495 bp
>NTDB_id=193991 BFM96_RS01395 WP_068989400.1 297148..297642(-) (ssbA) [Streptococcus himalayensis strain HTS2]
ATGCTAAATAATGTTGTTTTAGTGGGGCGACTTACAAAAGATGCTGAACTGAGATACACGCCCTCAAATGTGGCTGTTGC
CACCTTTACTCTTGCAGTTAATCGCCCTTTTAAAAATGAAGCTGGCGAGCGTGAGGCTGATTTTATCAATTGTGTTATCT
GGCGACAAGCGGCGGAAAATCTTGCAAACTGGGCTAAGAAAGGCTCATTGATTGGCATTACAGGCAGTATCCAGACACGC
AACTATGAAAATCAACAAGGGCAGCGCGTGTATGTGACAGAGGTTCTTGCTAGTCATTTCCAATTATTGGAAAGCAGACA
TCAACAAAATCAAGGACAACAGCAGGGAAATTATGATAATCAAGGTGGCAATTTCCAAAGCGGAAACAATCAAGGCTATA
ATCCATCAATGAATACAAATCCGCAACAAGGGTCATTTTTCCAAGGACAAACCACAAATCCTATGGATATTTCAGATGAT
GATTTGCCGTTTTAA
ATGCTAAATAATGTTGTTTTAGTGGGGCGACTTACAAAAGATGCTGAACTGAGATACACGCCCTCAAATGTGGCTGTTGC
CACCTTTACTCTTGCAGTTAATCGCCCTTTTAAAAATGAAGCTGGCGAGCGTGAGGCTGATTTTATCAATTGTGTTATCT
GGCGACAAGCGGCGGAAAATCTTGCAAACTGGGCTAAGAAAGGCTCATTGATTGGCATTACAGGCAGTATCCAGACACGC
AACTATGAAAATCAACAAGGGCAGCGCGTGTATGTGACAGAGGTTCTTGCTAGTCATTTCCAATTATTGGAAAGCAGACA
TCAACAAAATCAAGGACAACAGCAGGGAAATTATGATAATCAAGGTGGCAATTTCCAAAGCGGAAACAATCAAGGCTATA
ATCCATCAATGAATACAAATCCGCAACAAGGGTCATTTTTCCAAGGACAAACCACAAATCCTATGGATATTTCAGATGAT
GATTTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.616 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.322 |
100 |
0.598 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.941 |
72.561 |
0.384 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.357 |
68.293 |
0.378 |
| ssb | Glaesserella parasuis strain SC1401 |
33.889 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
34.286 |
100 |
0.366 |