Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | BEN15_RS04520 | Genome accession | NZ_CP016877 |
| Coordinates | 842495..842704 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain KLDS 3.1003 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 837495..847704
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BEN15_RS04485 (BEN15_04485) | - | 837904..838443 (+) | 540 | WP_418346454.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| BEN15_RS04490 (BEN15_04490) | - | 838754..839311 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| BEN15_RS04495 (BEN15_04495) | - | 839314..839964 (+) | 651 | WP_065972904.1 | phosphatase PAP2 family protein | - |
| BEN15_RS04500 (BEN15_04500) | comR | 840159..841058 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| BEN15_RS11580 | - | 841296..841727 (+) | 432 | Protein_812 | cysteine peptidase family C39 domain-containing protein | - |
| BEN15_RS11585 | - | 841757..842473 (+) | 717 | Protein_813 | ABC transporter transmembrane domain-containing protein | - |
| BEN15_RS04520 (BEN15_04520) | comA | 842495..842704 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| BEN15_RS04525 (BEN15_04525) | comA | 842759..843328 (+) | 570 | WP_065972905.1 | ATP-binding cassette domain-containing protein | Regulator |
| BEN15_RS11590 | - | 843559..843747 (+) | 189 | WP_224103239.1 | DUF805 domain-containing protein | - |
| BEN15_RS12130 | - | 843715..843999 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| BEN15_RS11600 (BEN15_04535) | - | 844239..845132 (-) | 894 | WP_014727319.1 | hypothetical protein | - |
| BEN15_RS04540 (BEN15_04540) | - | 845540..846055 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| BEN15_RS04545 (BEN15_04545) | - | 846080..846382 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| BEN15_RS04550 (BEN15_04550) | - | 846394..846705 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=193307 BEN15_RS04520 WP_002946147.1 842495..842704(+) (comA) [Streptococcus thermophilus strain KLDS 3.1003]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=193307 BEN15_RS04520 WP_002946147.1 842495..842704(+) (comA) [Streptococcus thermophilus strain KLDS 3.1003]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |