Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | BBD27_RS11375 | Genome accession | NZ_CP016394 |
| Coordinates | 558744..558953 (-) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ND07 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 553744..563953
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBD27_RS02880 (BBD27_0580) | - | 554673..554984 (-) | 312 | WP_002886559.1 | urease subunit beta | - |
| BBD27_RS02885 (BBD27_0581) | - | 554996..555298 (-) | 303 | WP_002886558.1 | urease subunit gamma | - |
| BBD27_RS02890 (BBD27_0582) | - | 555323..555838 (-) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| BBD27_RS11365 (BBD27_0583) | - | 556243..556614 (+) | 372 | WP_224107488.1 | hypothetical protein | - |
| BBD27_RS11370 (BBD27_0585) | - | 557056..557535 (+) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| BBD27_RS02900 (BBD27_0586) | - | 557681..558013 (-) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| BBD27_RS02905 (BBD27_0587) | - | 558121..558689 (-) | 569 | Protein_565 | ATP-binding cassette domain-containing protein | - |
| BBD27_RS11375 (BBD27_0588) | comA | 558744..558953 (-) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| BBD27_RS11380 (BBD27_ps17) | - | 558975..559691 (-) | 717 | Protein_567 | ABC transporter transmembrane domain-containing protein | - |
| BBD27_RS11385 | - | 559721..560215 (-) | 495 | Protein_568 | cysteine peptidase family C39 domain-containing protein | - |
| BBD27_RS02930 (BBD27_0590) | comR | 560390..561289 (-) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| BBD27_RS02935 (BBD27_0591) | - | 561484..562134 (-) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| BBD27_RS02940 (BBD27_0592) | - | 562137..562694 (-) | 558 | WP_024704183.1 | ECF transporter S component | - |
| BBD27_RS02945 (BBD27_0593) | - | 563005..563544 (-) | 540 | WP_370869438.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=187872 BBD27_RS11375 WP_002946147.1 558744..558953(-) (comA) [Streptococcus thermophilus strain ND07]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=187872 BBD27_RS11375 WP_002946147.1 558744..558953(-) (comA) [Streptococcus thermophilus strain ND07]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |