Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | A9958_RS07990 | Genome accession | NZ_CP016157 |
| Coordinates | 1671804..1672250 (-) | Length | 148 a.a. |
| NCBI ID | WP_106421052.1 | Uniprot ID | - |
| Organism | Staphylococcus simulans strain MR2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1640893..1680350 | 1671804..1672250 | within | 0 |
Gene organization within MGE regions
Location: 1640893..1680350
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9958_RS07775 (A9958_07720) | - | 1640893..1641315 (-) | 423 | WP_106421026.1 | hypothetical protein | - |
| A9958_RS07780 (A9958_07725) | - | 1641315..1641872 (-) | 558 | WP_106421027.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A9958_RS07785 (A9958_07730) | - | 1642289..1642474 (-) | 186 | WP_182475589.1 | hypothetical protein | - |
| A9958_RS07790 | - | 1642476..1642586 (-) | 111 | WP_105976116.1 | hypothetical protein | - |
| A9958_RS07795 | - | 1642660..1642811 (-) | 152 | Protein_1511 | hypothetical protein | - |
| A9958_RS07800 (A9958_07735) | - | 1643182..1643724 (-) | 543 | WP_105976114.1 | hypothetical protein | - |
| A9958_RS07805 (A9958_07740) | - | 1644434..1645906 (-) | 1473 | WP_105976113.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| A9958_RS07810 (A9958_07745) | - | 1645907..1646155 (-) | 249 | WP_105976112.1 | phage holin | - |
| A9958_RS07815 (A9958_07750) | - | 1646295..1646594 (-) | 300 | WP_106421028.1 | DUF2951 family protein | - |
| A9958_RS07820 (A9958_07755) | - | 1646651..1646929 (-) | 279 | WP_105976111.1 | hypothetical protein | - |
| A9958_RS07825 (A9958_07760) | - | 1646935..1648803 (-) | 1869 | WP_105976110.1 | phage tail spike protein | - |
| A9958_RS07830 (A9958_07765) | - | 1648820..1650472 (-) | 1653 | WP_106421029.1 | hypothetical protein | - |
| A9958_RS07835 (A9958_07770) | - | 1650483..1651412 (-) | 930 | WP_106421030.1 | phage tail domain-containing protein | - |
| A9958_RS07840 (A9958_07775) | - | 1651416..1655189 (-) | 3774 | WP_106421031.1 | phage tail protein | - |
| A9958_RS07845 (A9958_07780) | - | 1655212..1655526 (-) | 315 | WP_106421032.1 | hypothetical protein | - |
| A9958_RS07850 (A9958_07785) | - | 1655559..1656017 (-) | 459 | WP_106421033.1 | tail assembly chaperone | - |
| A9958_RS07855 (A9958_07790) | - | 1656085..1656642 (-) | 558 | WP_106421034.1 | phage tail protein | - |
| A9958_RS07860 (A9958_07795) | - | 1656656..1657126 (-) | 471 | WP_106421035.1 | hypothetical protein | - |
| A9958_RS07865 (A9958_07800) | - | 1657141..1657524 (-) | 384 | WP_106421036.1 | HK97 gp10 family phage protein | - |
| A9958_RS07870 (A9958_07805) | - | 1657528..1657851 (-) | 324 | WP_106421037.1 | head-tail adaptor protein | - |
| A9958_RS07875 (A9958_07810) | - | 1657841..1658161 (-) | 321 | WP_105976100.1 | phage head-tail connector protein | - |
| A9958_RS13955 | - | 1658173..1658340 (-) | 168 | WP_182671258.1 | hypothetical protein | - |
| A9958_RS07880 (A9958_07815) | - | 1658358..1659317 (-) | 960 | WP_105976099.1 | phage capsid protein | - |
| A9958_RS07885 (A9958_07820) | - | 1659332..1659901 (-) | 570 | WP_105976098.1 | phage scaffolding protein | - |
| A9958_RS07890 (A9958_07825) | - | 1660005..1660982 (-) | 978 | WP_158257427.1 | phage minor head protein | - |
| A9958_RS07895 (A9958_07830) | - | 1660960..1662312 (-) | 1353 | WP_142397735.1 | phage portal protein | - |
| A9958_RS07900 (A9958_07835) | - | 1662357..1663628 (-) | 1272 | WP_106421040.1 | PBSX family phage terminase large subunit | - |
| A9958_RS07905 (A9958_07840) | - | 1663628..1664005 (-) | 378 | WP_002480794.1 | hypothetical protein | - |
| A9958_RS07910 (A9958_07845) | - | 1664084..1664629 (-) | 546 | WP_106421041.1 | YfbU family protein | - |
| A9958_RS07915 (A9958_07850) | - | 1664826..1665251 (-) | 426 | WP_070548334.1 | transcriptional regulator | - |
| A9958_RS07920 (A9958_07855) | rinB | 1665378..1665554 (-) | 177 | WP_106421042.1 | transcriptional activator RinB | - |
| A9958_RS07925 (A9958_07860) | - | 1665557..1665853 (-) | 297 | WP_106421043.1 | hypothetical protein | - |
| A9958_RS07930 (A9958_07865) | - | 1665893..1666401 (-) | 509 | Protein_1539 | dUTPase | - |
| A9958_RS07935 (A9958_07870) | - | 1666398..1666625 (-) | 228 | WP_106421044.1 | hypothetical protein | - |
| A9958_RS07940 (A9958_07875) | - | 1666622..1666882 (-) | 261 | WP_106421045.1 | hypothetical protein | - |
| A9958_RS14170 | - | 1666884..1667015 (-) | 132 | WP_257790908.1 | hypothetical protein | - |
| A9958_RS13860 | - | 1667163..1667339 (-) | 177 | WP_158263702.1 | hypothetical protein | - |
| A9958_RS07945 (A9958_07880) | - | 1667340..1667759 (-) | 420 | WP_105976084.1 | DUF3310 domain-containing protein | - |
| A9958_RS07950 (A9958_07885) | - | 1667760..1668275 (-) | 516 | WP_106421046.1 | hypothetical protein | - |
| A9958_RS07955 (A9958_07890) | - | 1668288..1668479 (-) | 192 | WP_105980080.1 | hypothetical protein | - |
| A9958_RS07960 (A9958_07895) | - | 1668480..1668887 (-) | 408 | WP_106421047.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A9958_RS07970 (A9958_07905) | - | 1669053..1669826 (-) | 774 | WP_060804512.1 | ATP-binding protein | - |
| A9958_RS07975 (A9958_07910) | - | 1669839..1670576 (-) | 738 | WP_106421049.1 | conserved phage C-terminal domain-containing protein | - |
| A9958_RS07980 (A9958_07915) | - | 1670622..1671104 (+) | 483 | WP_106421050.1 | hypothetical protein | - |
| A9958_RS07985 (A9958_07920) | - | 1671120..1671791 (-) | 672 | WP_106421051.1 | putative HNHc nuclease | - |
| A9958_RS07990 (A9958_07925) | ssbA | 1671804..1672250 (-) | 447 | WP_106421052.1 | single-stranded DNA-binding protein | Machinery gene |
| A9958_RS07995 (A9958_07930) | - | 1672250..1672921 (-) | 672 | WP_106421053.1 | ERF family protein | - |
| A9958_RS08000 (A9958_07935) | - | 1672884..1673138 (-) | 255 | WP_106421054.1 | DUF2483 family protein | - |
| A9958_RS08005 (A9958_07940) | - | 1673131..1673355 (-) | 225 | WP_106421055.1 | hypothetical protein | - |
| A9958_RS08010 (A9958_07945) | - | 1673455..1673670 (-) | 216 | WP_106421056.1 | hypothetical protein | - |
| A9958_RS08015 (A9958_07950) | - | 1673683..1673985 (-) | 303 | WP_002480770.1 | DUF771 domain-containing protein | - |
| A9958_RS08020 (A9958_07955) | - | 1674100..1674423 (+) | 324 | WP_106421057.1 | hypothetical protein | - |
| A9958_RS13865 | - | 1674412..1674570 (-) | 159 | WP_159079669.1 | hypothetical protein | - |
| A9958_RS08025 (A9958_07960) | - | 1674617..1674844 (-) | 228 | WP_106421058.1 | type II toxin-antitoxin system antitoxin, TscA family | - |
| A9958_RS08030 (A9958_07965) | - | 1674845..1675618 (-) | 774 | WP_106421059.1 | phage antirepressor | - |
| A9958_RS08035 (A9958_07970) | - | 1675734..1675970 (+) | 237 | WP_105976070.1 | hypothetical protein | - |
| A9958_RS13960 | - | 1675963..1676124 (-) | 162 | WP_182477690.1 | hypothetical protein | - |
| A9958_RS08040 (A9958_07975) | - | 1676139..1676378 (-) | 240 | WP_106421060.1 | helix-turn-helix domain-containing protein | - |
| A9958_RS08045 (A9958_07980) | - | 1676571..1676903 (+) | 333 | WP_105996454.1 | helix-turn-helix domain-containing protein | - |
| A9958_RS08050 (A9958_07985) | - | 1676917..1677390 (+) | 474 | WP_106421061.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A9958_RS08055 (A9958_07990) | - | 1677395..1678018 (+) | 624 | WP_234016058.1 | DUF4352 domain-containing protein | - |
| A9958_RS13870 | - | 1678197..1678337 (+) | 141 | WP_158257428.1 | hypothetical protein | - |
| A9958_RS08060 (A9958_07995) | - | 1678432..1678947 (+) | 516 | WP_106421062.1 | hypothetical protein | - |
| A9958_RS08065 (A9958_08000) | - | 1678949..1679257 (+) | 309 | WP_106421063.1 | hypothetical protein | - |
| A9958_RS08070 (A9958_08005) | - | 1679322..1680350 (+) | 1029 | WP_106421064.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16698.38 Da Isoelectric Point: 4.9225
>NTDB_id=185869 A9958_RS07990 WP_106421052.1 1671804..1672250(-) (ssbA) [Staphylococcus simulans strain MR2]
MLNRVVLVGRLTKDPEFRTTQSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGIDGRLQSR
SYENAEGQRVFVTEVVCDSVQFLEPKNAQASNNNQSNNQVQQREKALQSENPFNNSNNFDMDTDDLPF
MLNRVVLVGRLTKDPEFRTTQSGVDVATFTLAVNRNFKSKNGEQQADFINCVVFRKQAENVNNYLNKGSLAGIDGRLQSR
SYENAEGQRVFVTEVVCDSVQFLEPKNAQASNNNQSNNQVQQREKALQSENPFNNSNNFDMDTDDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=185869 A9958_RS07990 WP_106421052.1 1671804..1672250(-) (ssbA) [Staphylococcus simulans strain MR2]
ATGTTAAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCGGAATTCAGAACAACGCAAAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAACGGAGAGCAGCAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGAAGTTTAGCAGGTATCGATGGTCGCTTACAATCACGA
AGTTATGAGAATGCGGAAGGACAAAGAGTATTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TGCACAAGCCTCAAACAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGAAAATCCATTCA
ATAATAGCAACAACTTTGATATGGATACGGATGATTTACCTTTCTAG
ATGTTAAACAGAGTCGTATTAGTAGGTCGCTTAACAAAAGACCCGGAATTCAGAACAACGCAAAGCGGTGTAGATGTAGC
AACATTCACACTAGCAGTCAACCGTAATTTTAAGAGTAAAAACGGAGAGCAGCAGGCGGACTTTATCAACTGTGTTGTAT
TCCGTAAACAAGCAGAAAACGTCAATAATTATTTGAATAAAGGAAGTTTAGCAGGTATCGATGGTCGCTTACAATCACGA
AGTTATGAGAATGCGGAAGGACAAAGAGTATTTGTTACGGAAGTCGTATGTGACAGTGTGCAATTCCTAGAACCTAAGAA
TGCACAAGCCTCAAACAATAACCAATCAAATAACCAAGTGCAGCAAAGAGAGAAGGCGCTTCAAAGCGAAAATCCATTCA
ATAATAGCAACAACTTTGATATGGATACGGATGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.655 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.574 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
71.622 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.514 |
100 |
0.385 |
| ssb | Glaesserella parasuis strain SC1401 |
30.601 |
100 |
0.378 |
| ssbA | Streptococcus mutans UA159 |
45.833 |
81.081 |
0.372 |