Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | A9497_RS11420 | Genome accession | NZ_CP016026 |
| Coordinates | 1427433..1427642 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain KLDS SM | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1422433..1432642
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9497_RS07485 (A9497_07485) | - | 1422842..1423381 (+) | 540 | WP_370869438.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| A9497_RS07490 (A9497_07490) | - | 1423692..1424249 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| A9497_RS07495 (A9497_07495) | - | 1424252..1424902 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| A9497_RS07500 (A9497_07500) | comR | 1425097..1425996 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| A9497_RS11410 | - | 1426234..1426665 (+) | 432 | Protein_1397 | cysteine peptidase family C39 domain-containing protein | - |
| A9497_RS11415 | - | 1426695..1427411 (+) | 717 | Protein_1398 | ABC transporter transmembrane domain-containing protein | - |
| A9497_RS11420 (A9497_07520) | comA | 1427433..1427642 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| A9497_RS07525 (A9497_07525) | - | 1427697..1428265 (+) | 569 | Protein_1400 | ATP-binding cassette domain-containing protein | - |
| A9497_RS07530 (A9497_07530) | - | 1428373..1428705 (+) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| A9497_RS11425 | - | 1428851..1429330 (-) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| A9497_RS11430 | - | 1429772..1430143 (-) | 372 | WP_224107488.1 | hypothetical protein | - |
| A9497_RS07540 (A9497_07540) | - | 1430548..1431063 (+) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| A9497_RS07545 (A9497_07545) | - | 1431088..1431390 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| A9497_RS07550 (A9497_07550) | - | 1431402..1431713 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=185415 A9497_RS11420 WP_002946147.1 1427433..1427642(+) (comA) [Streptococcus thermophilus strain KLDS SM]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=185415 A9497_RS11420 WP_002946147.1 1427433..1427642(+) (comA) [Streptococcus thermophilus strain KLDS SM]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |