Detailed information NTG0180404

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: A2I62_RS06750
• Genome accession: NZ_CP015531
• Coordinates: 1386416..1386742 (+)
• Length: 108 a.a.
• NCBI ID: WP_015900413.1
• Uniprot ID: -
• Organism: Staphylococcus carnosus strain TMW 2.146
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1381416..1391742

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A2I62_RS06720 (A2I62_06595)	-	1382170..1382370 (+)	201	WP_015900419.1	YqgQ family protein	-
A2I62_RS06725 (A2I62_06600)	-	1382370..1383356 (+)	987	WP_015900418.1	ROK family glucokinase	-
A2I62_RS06730 (A2I62_06605)	-	1383356..1383685 (+)	330	WP_015900417.1	MTH1187 family thiamine-binding protein	-
A2I62_RS06735 (A2I62_06610)	-	1383685..1384308 (+)	624	WP_015900416.1	MBL fold metallo-hydrolase	-
A2I62_RS06740 (A2I62_06615)	comGA	1384379..1385353 (+)	975	WP_015900415.1	competence type IV pilus ATPase ComGA	Machinery gene
A2I62_RS06745 (A2I62_06620)	comGB	1385325..1386398 (+)	1074	WP_015900414.1	competence type IV pilus assembly protein ComGB	-
A2I62_RS06750 (A2I62_06625)	comGC	1386416..1386742 (+)	327	WP_015900413.1	competence type IV pilus major pilin ComGC	Machinery gene
A2I62_RS06755 (A2I62_06630)	-	1386762..1387175 (+)	414	WP_231635362.1	prepilin-type cleavage/methylation domain-containing protein	-
A2I62_RS06760 (A2I62_06635)	-	1387156..1387452 (+)	297	WP_041612977.1	hypothetical protein	-
A2I62_RS06765 (A2I62_06640)	comGF	1387409..1387867 (+)	459	WP_158297486.1	competence type IV pilus minor pilin ComGF	-
A2I62_RS06770 (A2I62_06645)	-	1388038..1388577 (+)	540	WP_015900411.1	shikimate kinase	-
A2I62_RS06775 (A2I62_06650)	gcvT	1388768..1389862 (+)	1095	WP_015900410.1	glycine cleavage system aminomethyltransferase GcvT	-
A2I62_RS06780 (A2I62_06655)	gcvPA	1389883..1391229 (+)	1347	WP_015900409.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12186.36 Da
• Isoelectric Point: 9.8933

>NTDB_id=180404 A2I62_RS06750 WP_015900413.1 1386416..1386742(+) (comGC) [Staphylococcus carnosus strain TMW 2.146]
MKRYYFKLKNKNLKAFTLLEMLLVLLVISVLLILIIPNIAKQSEHVQATGCEAQQKMVNSQIEAYSLKNNRKPDSIDELV
TQGYLKEAQKKCKSGESITIKNGEASIS

Nucleotide

• Length: 327 bp

>NTDB_id=180404 A2I62_RS06750 WP_015900413.1 1386416..1386742(+) (comGC) [Staphylococcus carnosus strain TMW 2.146]
ATGAAAAGATATTACTTTAAATTGAAAAATAAAAACTTAAAAGCTTTTACATTGTTAGAAATGCTGCTTGTATTATTGGT
TATTAGTGTATTATTAATTTTAATTATACCGAATATCGCTAAACAATCTGAACATGTCCAGGCTACAGGTTGTGAGGCAC
AACAAAAAATGGTGAATAGTCAAATAGAAGCTTATTCACTTAAAAATAATAGAAAACCTGATAGTATTGATGAACTTGTT
ACACAAGGATATTTAAAAGAAGCTCAAAAGAAGTGTAAATCAGGAGAAAGTATAACAATAAAAAATGGTGAAGCATCAAT
TAGCTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-35)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	72.632	87.963	0.639
comGC	Staphylococcus aureus N315	72.632	87.963	0.639
comGC/cglC	Streptococcus mitis SK321	45.283	98.148	0.444
comGC/cglC	Streptococcus pneumoniae R6	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae D39	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae TIGR4	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae Rx1	44.34	98.148	0.435
comGC/cglC	Streptococcus mitis NCTC 12261	47.826	85.185	0.407
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	76.852	0.38
comGC	Bacillus subtilis subsp. subtilis str. 168	40.625	88.889	0.361