Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM27_RS11430 | Genome accession | NZ_CP014412 |
| Coordinates | 2163004..2163474 (-) | Length | 156 a.a. |
| NCBI ID | WP_050961221.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR14 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2133304..2178303 | 2163004..2163474 | within | 0 |
Gene organization within MGE regions
Location: 2133304..2178303
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM27_RS11200 (AYM27_10915) | scn | 2133304..2133654 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AYM27_RS11205 (AYM27_10920) | - | 2134339..2134788 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AYM27_RS15785 (AYM27_10925) | - | 2134883..2135218 (-) | 336 | Protein_2083 | SH3 domain-containing protein | - |
| AYM27_RS11230 (AYM27_10930) | sak | 2135868..2136359 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| AYM27_RS11235 (AYM27_10935) | - | 2136550..2137305 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AYM27_RS11240 (AYM27_10940) | - | 2137317..2137571 (-) | 255 | WP_000611512.1 | phage holin | - |
| AYM27_RS11245 (AYM27_10945) | - | 2137623..2137730 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AYM27_RS11250 | pepG1 | 2137783..2137917 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AYM27_RS11255 (AYM27_10950) | - | 2138109..2138405 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AYM27_RS11260 (AYM27_10955) | - | 2138463..2138750 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AYM27_RS11265 (AYM27_10960) | - | 2138797..2138949 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AYM27_RS11270 (AYM27_10965) | - | 2138939..2142724 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| AYM27_RS11275 (AYM27_10970) | - | 2142740..2144224 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AYM27_RS11280 (AYM27_10975) | - | 2144221..2148750 (-) | 4530 | WP_001549166.1 | phage tail tape measure protein | - |
| AYM27_RS15955 | - | 2148807..2148944 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| AYM27_RS11285 (AYM27_10980) | - | 2148995..2149345 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| AYM27_RS11290 | - | 2149395..2149634 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AYM27_RS11295 (AYM27_10985) | - | 2149661..2150305 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AYM27_RS11300 (AYM27_10990) | - | 2150309..2150713 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AYM27_RS11305 (AYM27_10995) | - | 2150710..2151114 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AYM27_RS11310 (AYM27_11000) | - | 2151111..2151473 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AYM27_RS11315 (AYM27_11005) | - | 2151457..2151741 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AYM27_RS11320 (AYM27_11010) | - | 2151731..2152015 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| AYM27_RS11325 (AYM27_11015) | - | 2152035..2153180 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AYM27_RS11330 (AYM27_11020) | - | 2153204..2153941 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AYM27_RS11335 (AYM27_11025) | - | 2153925..2155112 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| AYM27_RS11340 (AYM27_11030) | - | 2155128..2156789 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AYM27_RS11345 (AYM27_11035) | - | 2156786..2157130 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AYM27_RS11350 (AYM27_11040) | - | 2157260..2157559 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AYM27_RS11355 (AYM27_11045) | - | 2157791..2158207 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AYM27_RS11360 (AYM27_11050) | - | 2158235..2158435 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AYM27_RS11365 (AYM27_11055) | - | 2158435..2158584 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AYM27_RS11370 (AYM27_11060) | - | 2158581..2158967 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AYM27_RS11375 (AYM27_11065) | - | 2158964..2159170 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AYM27_RS11380 (AYM27_11070) | - | 2159167..2159412 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AYM27_RS11385 (AYM27_11075) | - | 2159449..2159982 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| AYM27_RS11390 (AYM27_11080) | - | 2159975..2160217 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AYM27_RS11395 (AYM27_11085) | - | 2160207..2160443 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AYM27_RS11400 (AYM27_11090) | - | 2160436..2160807 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AYM27_RS11405 (AYM27_11095) | - | 2160816..2161058 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AYM27_RS11410 (AYM27_11100) | - | 2161062..2161430 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM27_RS11415 (AYM27_11105) | - | 2161443..2161847 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM27_RS11420 (AYM27_11110) | - | 2161856..2162074 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AYM27_RS11425 (AYM27_11115) | - | 2162081..2162974 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AYM27_RS11430 (AYM27_11120) | ssbA | 2163004..2163474 (-) | 471 | WP_050961221.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM27_RS11435 (AYM27_11125) | - | 2163475..2164092 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AYM27_RS11440 (AYM27_11130) | - | 2164173..2165093 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AYM27_RS11445 (AYM27_11135) | - | 2165095..2167038 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AYM27_RS11450 | - | 2167047..2167310 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AYM27_RS11455 (AYM27_11140) | - | 2167319..2167579 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AYM27_RS11460 (AYM27_11145) | - | 2167560..2167879 (-) | 320 | Protein_2131 | DUF2482 family protein | - |
| AYM27_RS11465 (AYM27_11150) | - | 2167974..2168135 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AYM27_RS11470 (AYM27_11155) | - | 2168132..2168452 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AYM27_RS11475 (AYM27_11160) | - | 2168511..2168741 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AYM27_RS15960 | - | 2168738..2168914 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AYM27_RS11480 (AYM27_11165) | - | 2168930..2169682 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM27_RS11485 (AYM27_11170) | - | 2169733..2170062 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AYM27_RS11490 (AYM27_11175) | - | 2170051..2170266 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AYM27_RS11495 (AYM27_11180) | - | 2170282..2170545 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AYM27_RS11500 (AYM27_11185) | - | 2170542..2170715 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AYM27_RS11505 (AYM27_11190) | - | 2170678..2171391 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AYM27_RS11510 (AYM27_11195) | - | 2171407..2172339 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AYM27_RS11515 (AYM27_11200) | - | 2172345..2172686 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AYM27_RS11520 (AYM27_11205) | - | 2172890..2173072 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AYM27_RS11525 (AYM27_11210) | - | 2173150..2173863 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AYM27_RS11530 (AYM27_11215) | - | 2174054..2175091 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AYM27_RS11535 (AYM27_11220) | sph | 2175142..2175972 (+) | 831 | Protein_2147 | sphingomyelin phosphodiesterase | - |
| AYM27_RS11540 (AYM27_11225) | lukG | 2176210..2177226 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AYM27_RS11545 (AYM27_11230) | lukH | 2177248..2178303 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17625.52 Da Isoelectric Point: 4.9432
>NTDB_id=171251 AYM27_RS11430 WP_050961221.1 2163004..2163474(-) (ssbA) [Staphylococcus aureus strain USA300-SUR14]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=171251 AYM27_RS11430 WP_050961221.1 2163004..2163474(-) (ssbA) [Staphylococcus aureus strain USA300-SUR14]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.538 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |