Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM26_RS11410 | Genome accession | NZ_CP014409 |
| Coordinates | 2162834..2163304 (-) | Length | 156 a.a. |
| NCBI ID | WP_050961221.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2133134..2178133 | 2162834..2163304 | within | 0 |
Gene organization within MGE regions
Location: 2133134..2178133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM26_RS11180 (AYM26_10905) | scn | 2133134..2133484 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AYM26_RS11185 (AYM26_10910) | - | 2134169..2134618 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AYM26_RS15785 (AYM26_10915) | - | 2134713..2135048 (-) | 336 | Protein_2083 | SH3 domain-containing protein | - |
| AYM26_RS11210 (AYM26_10920) | sak | 2135698..2136189 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| AYM26_RS11215 (AYM26_10925) | - | 2136380..2137135 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AYM26_RS11220 (AYM26_10930) | - | 2137147..2137401 (-) | 255 | WP_000611512.1 | phage holin | - |
| AYM26_RS11225 (AYM26_10935) | - | 2137453..2137560 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AYM26_RS11230 | pepG1 | 2137613..2137747 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AYM26_RS11235 (AYM26_10940) | - | 2137939..2138235 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AYM26_RS11240 (AYM26_10945) | - | 2138293..2138580 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AYM26_RS11245 (AYM26_10950) | - | 2138627..2138779 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AYM26_RS11250 (AYM26_10955) | - | 2138769..2142554 (-) | 3786 | WP_077467069.1 | phage tail spike protein | - |
| AYM26_RS11255 (AYM26_10960) | - | 2142570..2144054 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AYM26_RS11260 (AYM26_10965) | - | 2144051..2148580 (-) | 4530 | WP_001549166.1 | phage tail tape measure protein | - |
| AYM26_RS15960 | - | 2148637..2148774 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| AYM26_RS11265 (AYM26_10970) | - | 2148825..2149175 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| AYM26_RS11270 | - | 2149225..2149464 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AYM26_RS11275 (AYM26_10975) | - | 2149491..2150135 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AYM26_RS11280 (AYM26_10980) | - | 2150139..2150543 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AYM26_RS11285 (AYM26_10985) | - | 2150540..2150944 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AYM26_RS11290 (AYM26_10990) | - | 2150941..2151303 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AYM26_RS11295 (AYM26_10995) | - | 2151287..2151571 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AYM26_RS11300 (AYM26_11000) | - | 2151561..2151845 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| AYM26_RS11305 (AYM26_11005) | - | 2151865..2153010 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AYM26_RS11310 (AYM26_11010) | - | 2153034..2153771 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AYM26_RS11315 (AYM26_11015) | - | 2153755..2154942 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| AYM26_RS11320 (AYM26_11020) | - | 2154958..2156619 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AYM26_RS11325 (AYM26_11025) | - | 2156616..2156960 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AYM26_RS11330 (AYM26_11030) | - | 2157090..2157389 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AYM26_RS11335 (AYM26_11035) | - | 2157621..2158037 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AYM26_RS11340 (AYM26_11040) | - | 2158065..2158265 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AYM26_RS11345 (AYM26_11045) | - | 2158265..2158414 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AYM26_RS11350 (AYM26_11050) | - | 2158411..2158797 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AYM26_RS11355 (AYM26_11055) | - | 2158794..2159000 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AYM26_RS11360 (AYM26_11060) | - | 2158997..2159242 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AYM26_RS11365 (AYM26_11065) | - | 2159279..2159812 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| AYM26_RS11370 (AYM26_11070) | - | 2159805..2160047 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AYM26_RS11375 (AYM26_11075) | - | 2160037..2160273 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AYM26_RS11380 (AYM26_11080) | - | 2160266..2160637 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AYM26_RS11385 (AYM26_11085) | - | 2160646..2160888 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AYM26_RS11390 (AYM26_11090) | - | 2160892..2161260 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM26_RS11395 (AYM26_11095) | - | 2161273..2161677 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM26_RS11400 (AYM26_11100) | - | 2161686..2161904 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AYM26_RS11405 (AYM26_11105) | - | 2161911..2162804 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AYM26_RS11410 (AYM26_11110) | ssbA | 2162834..2163304 (-) | 471 | WP_050961221.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM26_RS11415 (AYM26_11115) | - | 2163305..2163922 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AYM26_RS11420 (AYM26_11120) | - | 2164003..2164923 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AYM26_RS11425 (AYM26_11125) | - | 2164925..2166868 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AYM26_RS11430 (AYM26_11130) | - | 2166877..2167140 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AYM26_RS11435 (AYM26_11135) | - | 2167149..2167409 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AYM26_RS11440 (AYM26_11140) | - | 2167390..2167709 (-) | 320 | Protein_2131 | DUF2482 family protein | - |
| AYM26_RS11445 (AYM26_11145) | - | 2167804..2167965 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AYM26_RS11450 (AYM26_11150) | - | 2167962..2168282 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AYM26_RS11455 (AYM26_11155) | - | 2168341..2168571 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AYM26_RS15965 | - | 2168568..2168744 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AYM26_RS11460 (AYM26_11160) | - | 2168760..2169512 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM26_RS11465 (AYM26_11165) | - | 2169563..2169892 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AYM26_RS11470 (AYM26_11170) | - | 2169881..2170096 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AYM26_RS11475 (AYM26_11175) | - | 2170112..2170375 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AYM26_RS11480 (AYM26_11180) | - | 2170372..2170545 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AYM26_RS11485 (AYM26_11185) | - | 2170508..2171221 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AYM26_RS11490 (AYM26_11190) | - | 2171237..2172169 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AYM26_RS11495 (AYM26_11195) | - | 2172175..2172516 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AYM26_RS11500 (AYM26_11200) | - | 2172720..2172902 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AYM26_RS11505 (AYM26_11205) | - | 2172980..2173693 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AYM26_RS11510 (AYM26_11210) | - | 2173884..2174921 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AYM26_RS11515 (AYM26_11215) | sph | 2174972..2175802 (+) | 831 | Protein_2147 | sphingomyelin phosphodiesterase | - |
| AYM26_RS11520 (AYM26_11220) | lukG | 2176040..2177056 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AYM26_RS11525 (AYM26_11225) | lukH | 2177078..2178133 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17625.52 Da Isoelectric Point: 4.9432
>NTDB_id=171209 AYM26_RS11410 WP_050961221.1 2162834..2163304(-) (ssbA) [Staphylococcus aureus strain USA300-SUR13]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=171209 AYM26_RS11410 WP_050961221.1 2162834..2163304(-) (ssbA) [Staphylococcus aureus strain USA300-SUR13]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.538 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |