Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM20_RS11415 | Genome accession | NZ_CP014384 |
| Coordinates | 2162783..2163253 (-) | Length | 156 a.a. |
| NCBI ID | WP_050961221.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2133083..2189031 | 2162783..2163253 | within | 0 |
Gene organization within MGE regions
Location: 2133083..2189031
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM20_RS11195 (AYM20_10905) | scn | 2133083..2133433 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AYM20_RS11200 (AYM20_10910) | - | 2134118..2134567 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AYM20_RS11205 (AYM20_10915) | - | 2134662..2134997 (-) | 336 | Protein_2083 | SH3 domain-containing protein | - |
| AYM20_RS11215 (AYM20_10920) | sak | 2135647..2136138 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| AYM20_RS11220 (AYM20_10925) | - | 2136329..2137084 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AYM20_RS11225 (AYM20_10930) | - | 2137096..2137350 (-) | 255 | WP_000611512.1 | phage holin | - |
| AYM20_RS11230 (AYM20_10935) | - | 2137402..2137509 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AYM20_RS11235 | pepG1 | 2137562..2137696 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AYM20_RS11240 (AYM20_10940) | - | 2137888..2138184 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AYM20_RS11245 (AYM20_10945) | - | 2138242..2138529 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AYM20_RS11250 (AYM20_10950) | - | 2138576..2138728 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AYM20_RS11255 (AYM20_10955) | - | 2138718..2142503 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| AYM20_RS11260 (AYM20_10960) | - | 2142519..2144003 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AYM20_RS11265 (AYM20_10965) | - | 2144000..2148529 (-) | 4530 | WP_001549166.1 | phage tail tape measure protein | - |
| AYM20_RS15755 | - | 2148586..2148723 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| AYM20_RS11270 (AYM20_10970) | - | 2148774..2149124 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| AYM20_RS11275 | - | 2149174..2149413 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AYM20_RS11280 (AYM20_10975) | - | 2149440..2150084 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AYM20_RS11285 (AYM20_10980) | - | 2150088..2150492 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AYM20_RS11290 (AYM20_10985) | - | 2150489..2150893 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AYM20_RS11295 (AYM20_10990) | - | 2150890..2151252 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AYM20_RS11300 (AYM20_10995) | - | 2151236..2151520 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AYM20_RS11305 (AYM20_11000) | - | 2151510..2151794 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| AYM20_RS11310 (AYM20_11005) | - | 2151814..2152959 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AYM20_RS11315 (AYM20_11010) | - | 2152983..2153720 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AYM20_RS11320 (AYM20_11015) | - | 2153704..2154891 (-) | 1188 | WP_031899203.1 | phage portal protein | - |
| AYM20_RS11325 (AYM20_11020) | - | 2154907..2156568 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AYM20_RS11330 (AYM20_11025) | - | 2156565..2156909 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AYM20_RS11335 (AYM20_11030) | - | 2157039..2157338 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AYM20_RS11340 (AYM20_11035) | - | 2157570..2157986 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AYM20_RS11345 (AYM20_11040) | - | 2158014..2158214 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AYM20_RS11350 (AYM20_11045) | - | 2158214..2158363 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AYM20_RS11355 (AYM20_11050) | - | 2158360..2158746 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AYM20_RS11360 (AYM20_11055) | - | 2158743..2158949 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AYM20_RS11365 (AYM20_11060) | - | 2158946..2159191 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AYM20_RS11370 (AYM20_11065) | - | 2159228..2159761 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| AYM20_RS11375 (AYM20_11070) | - | 2159754..2159996 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AYM20_RS11380 (AYM20_11075) | - | 2159986..2160222 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AYM20_RS11385 (AYM20_11080) | - | 2160215..2160586 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AYM20_RS11390 (AYM20_11085) | - | 2160595..2160837 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AYM20_RS11395 (AYM20_11090) | - | 2160841..2161209 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM20_RS11400 (AYM20_11095) | - | 2161222..2161626 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM20_RS11405 (AYM20_11100) | - | 2161635..2161853 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AYM20_RS11410 (AYM20_11105) | - | 2161860..2162753 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AYM20_RS11415 (AYM20_11110) | ssbA | 2162783..2163253 (-) | 471 | WP_050961221.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM20_RS11420 (AYM20_11115) | - | 2163254..2163871 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AYM20_RS11425 (AYM20_11120) | - | 2163952..2164872 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AYM20_RS11430 (AYM20_11125) | - | 2164874..2166817 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AYM20_RS11435 (AYM20_11130) | - | 2166826..2167089 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AYM20_RS11440 (AYM20_11135) | - | 2167098..2167358 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AYM20_RS11445 (AYM20_11140) | - | 2167339..2167658 (-) | 320 | Protein_2131 | DUF2482 family protein | - |
| AYM20_RS11450 (AYM20_11145) | - | 2167753..2167914 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AYM20_RS11455 (AYM20_11150) | - | 2167911..2168231 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AYM20_RS11460 (AYM20_11155) | - | 2168290..2168520 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AYM20_RS15760 | - | 2168517..2168693 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AYM20_RS11465 (AYM20_11160) | - | 2168709..2169461 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM20_RS11470 (AYM20_11165) | - | 2169512..2169841 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AYM20_RS11475 (AYM20_11170) | - | 2169830..2170045 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AYM20_RS11480 (AYM20_11175) | - | 2170061..2170324 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AYM20_RS11485 (AYM20_11180) | - | 2170321..2170494 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AYM20_RS11490 (AYM20_11185) | - | 2170457..2171170 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AYM20_RS11495 (AYM20_11190) | - | 2171186..2172118 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AYM20_RS11500 (AYM20_11195) | - | 2172124..2172465 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AYM20_RS11505 (AYM20_11200) | - | 2172669..2172851 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AYM20_RS11510 (AYM20_11205) | - | 2172929..2173642 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AYM20_RS11515 (AYM20_11210) | - | 2173833..2174870 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AYM20_RS11520 (AYM20_11215) | sph | 2174921..2175751 (+) | 831 | Protein_2147 | sphingomyelin phosphodiesterase | - |
| AYM20_RS11525 (AYM20_11220) | lukG | 2175989..2177005 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AYM20_RS11530 (AYM20_11225) | lukH | 2177027..2178082 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| AYM20_RS11535 (AYM20_11230) | - | 2178517..2179740 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| AYM20_RS11540 (AYM20_11235) | - | 2180112..2180957 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| AYM20_RS11545 (AYM20_11240) | - | 2181019..2181930 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| AYM20_RS11550 (AYM20_11245) | - | 2182091..2183398 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| AYM20_RS11560 (AYM20_11250) | - | 2184251..2184694 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| AYM20_RS11565 (AYM20_11255) | - | 2184800..2185236 (-) | 437 | Protein_2155 | hypothetical protein | - |
| AYM20_RS11570 (AYM20_11260) | - | 2185554..2186144 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| AYM20_RS11575 (AYM20_11265) | - | 2186141..2186353 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| AYM20_RS11580 | - | 2186414..2186960 (+) | 547 | Protein_2158 | site-specific integrase | - |
| AYM20_RS11585 (AYM20_11275) | groL | 2187055..2188671 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| AYM20_RS11590 (AYM20_11280) | groES | 2188747..2189031 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17625.52 Da Isoelectric Point: 4.9432
>NTDB_id=170958 AYM20_RS11415 WP_050961221.1 2162783..2163253(-) (ssbA) [Staphylococcus aureus strain USA300-SUR7]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=170958 AYM20_RS11415 WP_050961221.1 2162783..2163253(-) (ssbA) [Staphylococcus aureus strain USA300-SUR7]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.538 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |