Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AYM15_RS11420 | Genome accession | NZ_CP014368 |
| Coordinates | 2162822..2163292 (-) | Length | 156 a.a. |
| NCBI ID | WP_050961221.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2133122..2189070 | 2162822..2163292 | within | 0 |
Gene organization within MGE regions
Location: 2133122..2189070
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM15_RS11200 (AYM15_10905) | scn | 2133122..2133472 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AYM15_RS11205 (AYM15_10910) | - | 2134157..2134606 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AYM15_RS11210 (AYM15_10915) | - | 2134701..2135036 (-) | 336 | Protein_2082 | SH3 domain-containing protein | - |
| AYM15_RS11220 (AYM15_10920) | sak | 2135686..2136177 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| AYM15_RS11225 (AYM15_10925) | - | 2136368..2137123 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AYM15_RS11230 (AYM15_10930) | - | 2137135..2137389 (-) | 255 | WP_000611512.1 | phage holin | - |
| AYM15_RS11235 (AYM15_10935) | - | 2137441..2137548 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AYM15_RS11240 | pepG1 | 2137601..2137735 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AYM15_RS11245 (AYM15_10940) | - | 2137927..2138223 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AYM15_RS11250 (AYM15_10945) | - | 2138281..2138568 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| AYM15_RS11255 (AYM15_10950) | - | 2138615..2138767 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| AYM15_RS11260 (AYM15_10955) | - | 2138757..2142542 (-) | 3786 | WP_077467069.1 | phage tail spike protein | - |
| AYM15_RS11265 (AYM15_10960) | - | 2142558..2144042 (-) | 1485 | WP_000567394.1 | phage tail domain-containing protein | - |
| AYM15_RS11270 (AYM15_10965) | - | 2144039..2148568 (-) | 4530 | WP_001549166.1 | phage tail tape measure protein | - |
| AYM15_RS15790 | - | 2148625..2148762 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| AYM15_RS11275 (AYM15_10970) | - | 2148813..2149163 (-) | 351 | WP_001096354.1 | hypothetical protein | - |
| AYM15_RS11280 | - | 2149213..2149452 (-) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| AYM15_RS11285 (AYM15_10975) | - | 2149479..2150123 (-) | 645 | WP_000260578.1 | major tail protein | - |
| AYM15_RS11290 (AYM15_10980) | - | 2150127..2150531 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| AYM15_RS11295 (AYM15_10985) | - | 2150528..2150932 (-) | 405 | WP_000114229.1 | HK97 gp10 family phage protein | - |
| AYM15_RS11300 (AYM15_10990) | - | 2150929..2151291 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| AYM15_RS11305 (AYM15_10995) | - | 2151275..2151559 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| AYM15_RS11310 (AYM15_11000) | - | 2151549..2151833 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| AYM15_RS11315 (AYM15_11005) | - | 2151853..2152998 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| AYM15_RS11320 (AYM15_11010) | - | 2153022..2153759 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| AYM15_RS11325 (AYM15_11015) | - | 2153743..2154930 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| AYM15_RS11330 (AYM15_11020) | - | 2154946..2156607 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| AYM15_RS11335 (AYM15_11025) | - | 2156604..2156948 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| AYM15_RS11340 (AYM15_11030) | - | 2157078..2157377 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| AYM15_RS11345 (AYM15_11035) | - | 2157609..2158025 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| AYM15_RS11350 (AYM15_11040) | - | 2158053..2158253 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| AYM15_RS11355 (AYM15_11045) | - | 2158253..2158402 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| AYM15_RS11360 (AYM15_11050) | - | 2158399..2158785 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| AYM15_RS11365 (AYM15_11055) | - | 2158782..2158988 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| AYM15_RS11370 (AYM15_11060) | - | 2158985..2159230 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AYM15_RS11375 (AYM15_11065) | - | 2159267..2159800 (-) | 534 | WP_000181819.1 | dUTP pyrophosphatase | - |
| AYM15_RS11380 (AYM15_11070) | - | 2159793..2160035 (-) | 243 | WP_000700108.1 | hypothetical protein | - |
| AYM15_RS11385 (AYM15_11075) | - | 2160025..2160261 (-) | 237 | WP_001065101.1 | DUF1024 family protein | - |
| AYM15_RS11390 (AYM15_11080) | - | 2160254..2160625 (-) | 372 | WP_001549172.1 | hypothetical protein | - |
| AYM15_RS11395 (AYM15_11085) | - | 2160634..2160876 (-) | 243 | WP_000131383.1 | phi PVL orf 51-like protein | - |
| AYM15_RS11400 (AYM15_11090) | - | 2160880..2161248 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| AYM15_RS11405 (AYM15_11095) | - | 2161261..2161665 (-) | 405 | WP_000401977.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYM15_RS11410 (AYM15_11100) | - | 2161674..2161892 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| AYM15_RS11415 (AYM15_11105) | - | 2161899..2162792 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| AYM15_RS11420 (AYM15_11110) | ssbA | 2162822..2163292 (-) | 471 | WP_050961221.1 | single-stranded DNA-binding protein | Machinery gene |
| AYM15_RS11425 (AYM15_11115) | - | 2163293..2163910 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| AYM15_RS11430 (AYM15_11120) | - | 2163991..2164911 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| AYM15_RS11435 (AYM15_11125) | - | 2164913..2166856 (-) | 1944 | WP_000700561.1 | AAA family ATPase | - |
| AYM15_RS11440 (AYM15_11130) | - | 2166865..2167128 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AYM15_RS11445 (AYM15_11135) | - | 2167137..2167397 (-) | 261 | WP_000291513.1 | DUF1108 family protein | - |
| AYM15_RS11450 (AYM15_11140) | - | 2167378..2167697 (-) | 320 | Protein_2130 | DUF2482 family protein | - |
| AYM15_RS11455 (AYM15_11145) | - | 2167792..2167953 (-) | 162 | WP_001285960.1 | DUF1270 domain-containing protein | - |
| AYM15_RS11460 (AYM15_11150) | - | 2167950..2168270 (-) | 321 | WP_001120199.1 | DUF771 domain-containing protein | - |
| AYM15_RS11465 (AYM15_11155) | - | 2168329..2168559 (+) | 231 | WP_000549548.1 | hypothetical protein | - |
| AYM15_RS15795 | - | 2168556..2168732 (-) | 177 | WP_001001356.1 | hypothetical protein | - |
| AYM15_RS11470 (AYM15_11160) | - | 2168748..2169500 (-) | 753 | WP_001148642.1 | phage antirepressor KilAC domain-containing protein | - |
| AYM15_RS11475 (AYM15_11165) | - | 2169551..2169880 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| AYM15_RS11480 (AYM15_11170) | - | 2169869..2170084 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| AYM15_RS11485 (AYM15_11175) | - | 2170100..2170363 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| AYM15_RS11490 (AYM15_11180) | - | 2170360..2170533 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| AYM15_RS11495 (AYM15_11185) | - | 2170496..2171209 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| AYM15_RS11500 (AYM15_11190) | - | 2171225..2172157 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| AYM15_RS11505 (AYM15_11195) | - | 2172163..2172504 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| AYM15_RS11510 (AYM15_11200) | - | 2172708..2172890 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| AYM15_RS11515 (AYM15_11205) | - | 2172968..2173681 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AYM15_RS11520 (AYM15_11210) | - | 2173872..2174909 (+) | 1038 | WP_000857199.1 | site-specific integrase | - |
| AYM15_RS11525 (AYM15_11215) | sph | 2174960..2175790 (+) | 831 | Protein_2146 | sphingomyelin phosphodiesterase | - |
| AYM15_RS11530 (AYM15_11220) | lukG | 2176028..2177044 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| AYM15_RS11535 (AYM15_11225) | lukH | 2177066..2178121 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| AYM15_RS11540 (AYM15_11230) | - | 2178556..2179779 (+) | 1224 | WP_000206639.1 | ArgE/DapE family deacylase | - |
| AYM15_RS11545 (AYM15_11235) | - | 2180151..2180996 (-) | 846 | WP_000812010.1 | class I SAM-dependent methyltransferase | - |
| AYM15_RS11550 (AYM15_11240) | - | 2181058..2181969 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| AYM15_RS11555 (AYM15_11245) | - | 2182130..2183437 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| AYM15_RS11565 (AYM15_11250) | - | 2184290..2184733 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| AYM15_RS11570 (AYM15_11255) | - | 2184839..2185275 (-) | 437 | Protein_2154 | hypothetical protein | - |
| AYM15_RS11575 (AYM15_11260) | - | 2185593..2186183 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| AYM15_RS11580 (AYM15_11265) | - | 2186180..2186392 (-) | 213 | WP_000128898.1 | hypothetical protein | - |
| AYM15_RS11585 | - | 2186453..2186999 (+) | 547 | Protein_2157 | site-specific integrase | - |
| AYM15_RS11590 (AYM15_11275) | groL | 2187094..2188710 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| AYM15_RS11595 (AYM15_11280) | groES | 2188786..2189070 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17625.52 Da Isoelectric Point: 4.9432
>NTDB_id=170791 AYM15_RS11420 WP_050961221.1 2162822..2163292(-) (ssbA) [Staphylococcus aureus strain USA300-SUR3]
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGELEADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=170791 AYM15_RS11420 WP_050961221.1 2162822..2163292(-) (ssbA) [Staphylococcus aureus strain USA300-SUR3]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAATGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCTCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
49.412 |
100 |
0.538 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |