Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ASL16_RS05730 Genome accession   NZ_CP013953
Coordinates   1160214..1160684 (+) Length   156 a.a.
NCBI ID   WP_000934768.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NCCP14558 isolate sequencing     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1144450..1192141 1160214..1160684 within 0


Gene organization within MGE regions


Location: 1144450..1192141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ASL16_RS05610 (ASL16_05615) - 1144450..1145376 (-) 927 WP_000757575.1 glycerophosphodiester phosphodiesterase -
  ASL16_RS05615 (ASL16_05620) - 1145615..1145869 (+) 255 WP_001049150.1 YlbG family protein -
  ASL16_RS05620 (ASL16_05625) - 1145872..1146261 (-) 390 WP_000814565.1 DUF7147 family protein -
  ASL16_RS05625 (ASL16_05630) rsmD 1146331..1146873 (+) 543 WP_001263796.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  ASL16_RS05630 (ASL16_05635) coaD 1146875..1147357 (+) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  ASL16_RS05635 (ASL16_05640) - 1147419..1148558 (-) 1140 WP_000843611.1 nucleotidyltransferase -
  ASL16_RS05640 (ASL16_05645) - 1148685..1149242 (+) 558 WP_000872158.1 YceD family protein -
  ASL16_RS05650 (ASL16_05655) rpmF 1149322..1149495 (+) 174 WP_000290472.1 50S ribosomal protein L32 -
  ASL16_RS05655 (ASL16_05660) - 1149612..1150997 (-) 1386 WP_000861313.1 recombinase family protein -
  ASL16_RS05660 (ASL16_05665) - 1151204..1151884 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  ASL16_RS05665 (ASL16_05670) - 1151920..1152639 (-) 720 WP_000358220.1 XRE family transcriptional regulator -
  ASL16_RS05670 (ASL16_05675) - 1152781..1152999 (+) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  ASL16_RS05675 (ASL16_05680) - 1153014..1153322 (+) 309 WP_001153965.1 hypothetical protein -
  ASL16_RS05680 (ASL16_05685) - 1153479..1154270 (+) 792 WP_001148569.1 phage antirepressor -
  ASL16_RS05685 (ASL16_05690) tscA 1154271..1154495 (+) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  ASL16_RS05690 (ASL16_05695) - 1154535..1154678 (+) 144 WP_000939498.1 hypothetical protein -
  ASL16_RS05695 (ASL16_05700) - 1154700..1155347 (-) 648 WP_001838167.1 hypothetical protein -
  ASL16_RS16475 - 1155406..1155534 (+) 129 WP_001559112.1 hypothetical protein -
  ASL16_RS05700 (ASL16_05705) - 1155527..1155694 (+) 168 WP_001285957.1 DUF1270 domain-containing protein -
  ASL16_RS05705 (ASL16_05710) - 1155695..1156015 (+) 321 WP_000219666.1 hypothetical protein -
  ASL16_RS05710 (ASL16_05715) - 1156109..1156369 (+) 261 WP_000291075.1 DUF1108 family protein -
  ASL16_RS15520 - 1156378..1156641 (+) 264 WP_001205732.1 hypothetical protein -
  ASL16_RS05715 (ASL16_05720) - 1156650..1158593 (+) 1944 WP_000700555.1 AAA family ATPase -
  ASL16_RS05720 (ASL16_05725) - 1158595..1159515 (+) 921 WP_000138475.1 recombinase RecT -
  ASL16_RS05725 (ASL16_05730) - 1159596..1160213 (+) 618 WP_071890040.1 MBL fold metallo-hydrolase -
  ASL16_RS05730 (ASL16_05735) ssbA 1160214..1160684 (+) 471 WP_000934768.1 single-stranded DNA-binding protein Machinery gene
  ASL16_RS05735 (ASL16_05740) - 1160714..1161601 (+) 888 WP_000148306.1 DnaD domain protein -
  ASL16_RS05740 (ASL16_05745) - 1161608..1161826 (+) 219 WP_000338528.1 hypothetical protein -
  ASL16_RS05745 (ASL16_05750) - 1161835..1162239 (+) 405 WP_000401973.1 RusA family crossover junction endodeoxyribonuclease -
  ASL16_RS05750 (ASL16_05755) - 1162252..1162629 (+) 378 WP_031875644.1 SA1788 family PVL leukocidin-associated protein -
  ASL16_RS05755 (ASL16_05760) - 1162630..1162878 (+) 249 WP_015980409.1 phi PVL orf 51-like protein -
  ASL16_RS05760 (ASL16_05765) - 1162891..1163292 (+) 402 WP_015978402.1 hypothetical protein -
  ASL16_RS05765 (ASL16_05770) - 1163289..1163573 (+) 285 WP_001105618.1 hypothetical protein -
  ASL16_RS05770 (ASL16_05775) - 1163566..1163814 (+) 249 WP_001065026.1 DUF1024 family protein -
  ASL16_RS05775 (ASL16_05780) - 1163807..1164343 (+) 537 WP_031789556.1 dUTPase -
  ASL16_RS05780 (ASL16_05785) - 1164380..1164586 (+) 207 WP_000195810.1 DUF1381 domain-containing protein -
  ASL16_RS05785 (ASL16_05790) rinB 1164583..1164756 (+) 174 WP_000595257.1 transcriptional activator RinB -
  ASL16_RS05790 (ASL16_05795) - 1164757..1164903 (+) 147 WP_000990001.1 hypothetical protein -
  ASL16_RS05795 (ASL16_05800) - 1164927..1165349 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  ASL16_RS05800 (ASL16_05805) - 1165536..1165976 (+) 441 WP_001003272.1 terminase small subunit -
  ASL16_RS05805 (ASL16_05810) - 1165963..1167240 (+) 1278 WP_000169945.1 PBSX family phage terminase large subunit -
  ASL16_RS05810 (ASL16_05815) - 1167251..1168789 (+) 1539 WP_001568999.1 phage portal protein -
  ASL16_RS05815 (ASL16_05820) - 1168796..1169791 (+) 996 WP_031794387.1 minor capsid protein -
  ASL16_RS05820 (ASL16_05825) - 1169864..1170034 (+) 171 WP_000072208.1 hypothetical protein -
  ASL16_RS16320 - 1170062..1170149 (+) 88 Protein_1125 hypothetical protein -
  ASL16_RS05825 (ASL16_05830) - 1170143..1170763 (+) 621 WP_063663447.1 DUF4355 domain-containing protein -
  ASL16_RS05830 (ASL16_05835) - 1170777..1171751 (+) 975 WP_000438512.1 phage major capsid protein -
  ASL16_RS05835 (ASL16_05840) - 1171773..1172060 (+) 288 WP_031771475.1 hypothetical protein -
  ASL16_RS05840 (ASL16_05845) - 1172069..1172401 (+) 333 WP_000208960.1 phage head-tail connector protein -
  ASL16_RS05845 (ASL16_05850) - 1172398..1172700 (+) 303 WP_009560319.1 hypothetical protein -
  ASL16_RS05850 (ASL16_05855) - 1172700..1173047 (+) 348 WP_001017811.1 HK97-gp10 family putative phage morphogenesis protein -
  ASL16_RS05855 (ASL16_05860) - 1173059..1173442 (+) 384 WP_000188653.1 hypothetical protein -
  ASL16_RS05860 (ASL16_05865) - 1173461..1174042 (+) 582 WP_000002583.1 phage major tail protein, TP901-1 family -
  ASL16_RS05865 (ASL16_05870) - 1174104..1174469 (+) 366 WP_001100163.1 tail assembly chaperone -
  ASL16_RS05870 (ASL16_05875) - 1174499..1174843 (+) 345 WP_000105584.1 hypothetical protein -
  ASL16_RS05875 (ASL16_05880) - 1174860..1178324 (+) 3465 WP_031881830.1 membrane protein -
  ASL16_RS05880 (ASL16_05885) - 1178337..1179284 (+) 948 WP_031881831.1 phage tail family protein -
  ASL16_RS05885 (ASL16_05890) - 1179293..1181194 (+) 1902 WP_031783966.1 SGNH/GDSL hydrolase family protein -
  ASL16_RS05890 (ASL16_05895) - 1181209..1183119 (+) 1911 WP_031898410.1 hypothetical protein -
  ASL16_RS05895 (ASL16_05900) - 1183119..1184942 (+) 1824 WP_000259596.1 phage baseplate upper protein -
  ASL16_RS05900 (ASL16_05905) - 1184942..1185319 (+) 378 WP_000705902.1 DUF2977 domain-containing protein -
  ASL16_RS05905 (ASL16_05910) - 1185323..1185496 (+) 174 WP_001800921.1 XkdX family protein -
  ASL16_RS05910 (ASL16_05915) - 1185537..1185836 (+) 300 WP_000466767.1 DUF2951 domain-containing protein -
  ASL16_RS05915 (ASL16_05920) - 1185973..1187871 (+) 1899 WP_063663450.1 glucosaminidase domain-containing protein -
  ASL16_RS05920 (ASL16_05925) - 1187884..1189056 (+) 1173 WP_063663453.1 BppU family phage baseplate upper protein -
  ASL16_RS05925 (ASL16_05930) - 1189062..1189457 (+) 396 WP_000398882.1 hypothetical protein -
  ASL16_RS05930 (ASL16_05935) - 1189515..1189952 (+) 438 WP_000354135.1 phage holin -
  ASL16_RS05935 (ASL16_05940) - 1189933..1191378 (+) 1446 WP_001148142.1 SH3 domain-containing protein -
  ASL16_RS05940 (ASL16_05945) - 1191621..1191773 (+) 153 WP_001788502.1 hypothetical protein -
  ASL16_RS05945 (ASL16_05950) - 1191844..1191954 (+) 111 WP_000139423.1 hypothetical protein -
  ASL16_RS05950 (ASL16_05955) - 1191956..1192141 (+) 186 WP_001286805.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17747.64 Da        Isoelectric Point: 4.9816

>NTDB_id=166563 ASL16_RS05730 WP_000934768.1 1160214..1160684(+) (ssbA) [Staphylococcus aureus strain NCCP14558 isolate sequencing]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=166563 ASL16_RS05730 WP_000934768.1 1160214..1160684(+) (ssbA) [Staphylococcus aureus strain NCCP14558 isolate sequencing]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment