Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LLUC063_RS11040 | Genome accession | NZ_CP015905 |
| Coordinates | 2170315..2170584 (-) | Length | 89 a.a. |
| NCBI ID | WP_003129998.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain UC063 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2165315..2175584
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC063_RS11000 (LLUC063_2146) | - | 2165564..2166301 (-) | 738 | WP_058221575.1 | metal ABC transporter ATP-binding protein | - |
| LLUC063_RS11005 (LLUC063_2147) | - | 2166478..2167320 (-) | 843 | WP_003129990.1 | metal ABC transporter substrate-binding protein | - |
| LLUC063_RS11010 (LLUC063_2148) | - | 2167317..2167754 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC063_RS11015 (LLUC063_2149) | - | 2167961..2168908 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LLUC063_RS11020 (LLUC063_2150) | comGG | 2168882..2169208 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC063_RS11025 (LLUC063_2151) | comGF | 2169247..2169693 (-) | 447 | WP_058225890.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC063_RS11030 (LLUC063_2152) | comGE | 2169656..2169952 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC063_RS11035 (LLUC063_2153) | comGD | 2169924..2170355 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLUC063_RS11040 (LLUC063_2154) | comGC | 2170315..2170584 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUC063_RS11045 (LLUC063_2155) | - | 2170758..2171225 (-) | 468 | WP_058225891.1 | hypothetical protein | - |
| LLUC063_RS11050 (LLUC063_2156) | - | 2171308..2171481 (-) | 174 | WP_160321615.1 | hypothetical protein | - |
| LLUC063_RS11055 (LLUC063_2157) | - | 2171568..2172347 (-) | 780 | WP_058225892.1 | peptidoglycan amidohydrolase family protein | - |
| LLUC063_RS11060 (LLUC063_2158) | - | 2172347..2172634 (-) | 288 | WP_023164507.1 | phage holin | - |
| LLUC063_RS11065 (LLUC063_2159) | - | 2172647..2172997 (-) | 351 | WP_058225893.1 | hypothetical protein | - |
| LLUC063_RS11070 (LLUC063_2160) | - | 2173010..2173246 (-) | 237 | WP_081196280.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 89 a.a. Molecular weight: 10123.56 Da Isoelectric Point: 4.2950
>NTDB_id=156102 LLUC063_RS11040 WP_003129998.1 2170315..2170584(-) (comGC) [Lactococcus lactis subsp. lactis strain UC063]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQN
KNEERNFND
Nucleotide
Download Length: 270 bp
>NTDB_id=156102 LLUC063_RS11040 WP_003129998.1 2170315..2170584(-) (comGC) [Lactococcus lactis subsp. lactis strain UC063]
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
ATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAC
AAAAATGAAGAACGAAATTTTAATGACTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Lactococcus lactis subsp. cremoris KW2 |
86.667 |
84.27 |
0.73 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae D39 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae R6 |
55.056 |
100 |
0.551 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
55.056 |
100 |
0.551 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
56.471 |
95.506 |
0.539 |
| comGC | Streptococcus suis isolate S10 |
58.904 |
82.022 |
0.483 |
| comGC/cglC | Streptococcus mitis SK321 |
53.947 |
85.393 |
0.461 |
| comGC | Streptococcus mutans UA140 |
50.685 |
82.022 |
0.416 |
| comGC | Streptococcus mutans UA159 |
50.685 |
82.022 |
0.416 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
56.25 |
71.91 |
0.404 |