Detailed information
Overview
| Name | comD/blpH | Type | Regulator |
| Locus tag | V471_RS11300 | Genome accession | NZ_CP015283 |
| Coordinates | 844466..844636 (-) | Length | 56 a.a. |
| NCBI ID | WP_157108264.1 | Uniprot ID | - |
| Organism | Streptococcus salivarius strain ATCC 25975 | ||
| Function | phosphorylation of ComE; regulation of comX expression (predicted from homology) Competence regulation |
||
Genomic Context
Location: 839466..849636
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V471_RS04410 (V471_04350) | - | 840466..840687 (+) | 222 | WP_022495973.1 | garvicin Q family class II bacteriocin | - |
| V471_RS04420 (V471_04355) | comA/nlmT | 841160..843316 (+) | 2157 | WP_002883725.1 | peptide cleavage/export ABC transporter | Regulator |
| V471_RS04425 (V471_04360) | - | 843401..844378 (+) | 978 | WP_232326838.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| V471_RS11300 | comD/blpH | 844466..844636 (-) | 171 | WP_157108264.1 | GHKL domain-containing protein | Regulator |
| V471_RS04430 (V471_04365) | - | 844739..845125 (-) | 387 | WP_045768432.1 | IS110 family transposase | - |
| V471_RS04435 (V471_04370) | - | 845145..845906 (-) | 762 | WP_049529073.1 | IS110 family transposase | - |
| V471_RS11065 | comD/comD1 | 846115..846624 (-) | 510 | WP_198166466.1 | GHKL domain-containing protein | Regulator |
| V471_RS04445 (V471_04380) | comE/blpR | 847278..848015 (-) | 738 | WP_002883766.1 | LytR/AlgR family response regulator transcription factor | Regulator |
| V471_RS04450 (V471_04385) | - | 848744..849556 (-) | 813 | WP_002889987.1 | HAD family hydrolase | - |
Sequence
Protein
Download Length: 56 a.a. Molecular weight: 6386.33 Da Isoelectric Point: 10.0401
>NTDB_id=153209 V471_RS11300 WP_157108264.1 844466..844636(-) (comD/blpH) [Streptococcus salivarius strain ATCC 25975]
MSITKIFQKGFSSKGTDRGIGLASIREILEYYPNVSLNTRSVAYEFTQDLIIRQKT
MSITKIFQKGFSSKGTDRGIGLASIREILEYYPNVSLNTRSVAYEFTQDLIIRQKT
Nucleotide
Download Length: 171 bp
>NTDB_id=153209 V471_RS11300 WP_157108264.1 844466..844636(-) (comD/blpH) [Streptococcus salivarius strain ATCC 25975]
ATCTCTATTACCAAAATCTTTCAAAAAGGTTTCTCAAGCAAAGGAACTGACCGTGGTATTGGTCTAGCTAGTATAAGAGA
GATACTAGAGTATTATCCCAACGTTTCTCTTAATACTAGAAGTGTGGCATATGAGTTTACTCAGGACCTAATTATAAGAC
AAAAAACTTGA
ATCTCTATTACCAAAATCTTTCAAAAAGGTTTCTCAAGCAAAGGAACTGACCGTGGTATTGGTCTAGCTAGTATAAGAGA
GATACTAGAGTATTATCCCAACGTTTCTCTTAATACTAGAAGTGTGGCATATGAGTTTACTCAGGACCTAATTATAAGAC
AAAAAACTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comD/blpH | Streptococcus mutans UA159 |
47.17 |
94.643 |
0.446 |
| comD/comD1 | Streptococcus equinus JB1 |
39.286 |
100 |
0.393 |
| comD | Streptococcus mitis SK321 |
44 |
89.286 |
0.393 |
| comD | Streptococcus mitis NCTC 12261 |
44 |
89.286 |
0.393 |
| comD/comD2 | Streptococcus pneumoniae TIGR4 |
44 |
89.286 |
0.393 |
| comD/comD1 | Streptococcus pneumoniae Rx1 |
44 |
89.286 |
0.393 |
| comD/comD1 | Streptococcus pneumoniae D39 |
44 |
89.286 |
0.393 |
| comD/comD1 | Streptococcus pneumoniae R6 |
44 |
89.286 |
0.393 |
| comD/comD3 | Streptococcus equinus JB1 |
50 |
78.571 |
0.393 |