Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | PLANO_RS15155 | Genome accession | NZ_CP009129 |
| Coordinates | 3089729..3090208 (-) | Length | 159 a.a. |
| NCBI ID | WP_038705252.1 | Uniprot ID | A0A0B4RFI6 |
| Organism | Planococcus sp. PAMC 21323 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3082115..3133476 | 3089729..3090208 | within | 0 |
Gene organization within MGE regions
Location: 3082115..3133476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PLANO_RS15120 (Plano_2996) | yycF | 3082115..3082822 (-) | 708 | WP_038705497.1 | response regulator YycF | - |
| PLANO_RS15125 (Plano_2997) | - | 3083047..3084333 (-) | 1287 | WP_038705247.1 | adenylosuccinate synthase | - |
| PLANO_RS15130 (Plano_2998) | dnaB | 3084466..3085821 (-) | 1356 | WP_038705248.1 | replicative DNA helicase | - |
| PLANO_RS15135 (Plano_2999) | rplI | 3085834..3086283 (-) | 450 | WP_038705249.1 | 50S ribosomal protein L9 | - |
| PLANO_RS15140 (Plano_3000) | - | 3086280..3088253 (-) | 1974 | WP_038705250.1 | DHH family phosphoesterase | - |
| PLANO_RS15145 (Plano_3001) | - | 3088268..3089227 (-) | 960 | WP_038705251.1 | DUF2232 domain-containing protein | - |
| PLANO_RS15150 (Plano_3002) | rpsR | 3089443..3089679 (-) | 237 | WP_006830564.1 | 30S ribosomal protein S18 | - |
| PLANO_RS15155 (Plano_3003) | ssbA | 3089729..3090208 (-) | 480 | WP_038705252.1 | single-stranded DNA-binding protein | Machinery gene |
| PLANO_RS15160 (Plano_3004) | rpsF | 3090259..3090546 (-) | 288 | WP_038705253.1 | 30S ribosomal protein S6 | - |
| PLANO_RS15165 (Plano_3005) | - | 3090725..3091282 (+) | 558 | WP_052124347.1 | DUF3267 domain-containing protein | - |
| PLANO_RS15170 (Plano_3006) | - | 3091295..3091675 (-) | 381 | WP_038705254.1 | gamma-glutamylcyclotransferase family protein | - |
| PLANO_RS15175 (Plano_3007) | ychF | 3091775..3092875 (-) | 1101 | WP_038705499.1 | redox-regulated ATPase YchF | - |
| PLANO_RS15180 (Plano_3008) | - | 3092964..3093164 (-) | 201 | WP_038705255.1 | DUF951 domain-containing protein | - |
| PLANO_RS15185 (Plano_3009) | - | 3093180..3094073 (-) | 894 | WP_038705256.1 | mechanosensitive ion channel family protein | - |
| PLANO_RS15190 (Plano_3010) | - | 3094093..3094806 (-) | 714 | WP_038705257.1 | DUF554 domain-containing protein | - |
| PLANO_RS15195 (Plano_3011) | - | 3094935..3095768 (-) | 834 | WP_038705258.1 | ParB/RepB/Spo0J family partition protein | - |
| PLANO_RS15200 (Plano_3012) | - | 3095761..3096522 (-) | 762 | WP_038705259.1 | AAA family ATPase | - |
| PLANO_RS15205 (Plano_3013) | noc | 3096744..3097607 (-) | 864 | WP_038705260.1 | nucleoid occlusion protein | - |
| PLANO_RS15210 (Plano_3014) | rsmG | 3097692..3098405 (-) | 714 | WP_038705261.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| PLANO_RS15215 (Plano_3015) | mnmG | 3098508..3100397 (-) | 1890 | WP_038705262.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| PLANO_RS15220 (Plano_3016) | mnmE | 3100420..3101805 (-) | 1386 | WP_038705263.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| PLANO_RS15225 (Plano_3017) | jag | 3102072..3102800 (-) | 729 | WP_038705264.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| PLANO_RS15230 (Plano_3018) | yidC | 3102797..3103576 (-) | 780 | WP_038705265.1 | membrane protein insertase YidC | - |
| PLANO_RS15235 (Plano_3019) | rnpA | 3103637..3103978 (-) | 342 | WP_038705266.1 | ribonuclease P protein component | - |
| PLANO_RS15240 (Plano_3020) | rpmH | 3104061..3104198 (-) | 138 | WP_038705267.1 | 50S ribosomal protein L34 | - |
| PLANO_RS15245 (Plano_3021) | dnaA | 3104688..3106031 (+) | 1344 | WP_038705268.1 | chromosomal replication initiator protein DnaA | - |
| PLANO_RS15250 (Plano_3022) | dnaN | 3106205..3107341 (+) | 1137 | WP_038705269.1 | DNA polymerase III subunit beta | - |
| PLANO_RS15255 (Plano_3023) | yaaA | 3107449..3107688 (+) | 240 | WP_038705270.1 | S4 domain-containing protein YaaA | - |
| PLANO_RS15260 (Plano_3024) | recF | 3107678..3108790 (+) | 1113 | WP_038705271.1 | DNA replication/repair protein RecF | - |
| PLANO_RS15265 (Plano_3025) | gyrB | 3108876..3110798 (+) | 1923 | WP_231554792.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| PLANO_RS15270 (Plano_3026) | gyrA | 3110829..3113396 (+) | 2568 | WP_038705273.1 | DNA gyrase subunit A | - |
| PLANO_RS15290 (Plano_3027) | guaB | 3119444..3120907 (+) | 1464 | WP_038705274.1 | IMP dehydrogenase | - |
| PLANO_RS15295 (Plano_3028) | - | 3121017..3122375 (+) | 1359 | WP_038705275.1 | serine hydrolase | - |
| PLANO_RS15300 (Plano_3029) | - | 3122415..3123809 (-) | 1395 | WP_038705276.1 | PLP-dependent aminotransferase family protein | - |
| PLANO_RS15305 (Plano_3030) | pdxS | 3123914..3124798 (+) | 885 | WP_038705277.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| PLANO_RS15310 (Plano_3031) | pdxT | 3124801..3125415 (+) | 615 | WP_038705278.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| PLANO_RS15315 (Plano_3032) | serS | 3125696..3126970 (+) | 1275 | WP_038705279.1 | serine--tRNA ligase | - |
| PLANO_RS15320 (Plano_3033) | - | 3127067..3127927 (+) | 861 | WP_038705280.1 | alpha/beta hydrolase | - |
| PLANO_RS15325 (Plano_3034) | tadA | 3127943..3128434 (-) | 492 | WP_156108916.1 | tRNA adenosine(34) deaminase TadA | - |
| PLANO_RS15330 (Plano_3035) | - | 3128558..3129418 (+) | 861 | WP_038705281.1 | YitT family protein | - |
| PLANO_RS15335 (Plano_3036) | - | 3129514..3130152 (+) | 639 | WP_038705282.1 | deoxynucleoside kinase | - |
| PLANO_RS15340 (Plano_3037) | - | 3130149..3130817 (+) | 669 | WP_038705283.1 | deoxynucleoside kinase | - |
| PLANO_RS15350 (Plano_3038) | dnaX | 3131743..3133476 (+) | 1734 | WP_038705284.1 | DNA polymerase III subunit gamma/tau | - |
Sequence
Protein
Download Length: 159 a.a. Molecular weight: 17484.11 Da Isoelectric Point: 4.9561
>NTDB_id=127048 PLANO_RS15155 WP_038705252.1 3089729..3090208(-) (ssbA) [Planococcus sp. PAMC 21323]
MINRVVLVGRLTKDPDLRYTPSGAAVARFTLAVNRTFSNAQGEREADFINCTVWRKQAENTANFLKKGSLAGVEGRIQTG
SYEGQDGKRVYTTEVVADSVQFLEPKNANANTDRSQGQQPSYQQNQSPSPSQQNHTRVDEDPFSSGSGPIEVSDDDLPF
MINRVVLVGRLTKDPDLRYTPSGAAVARFTLAVNRTFSNAQGEREADFINCTVWRKQAENTANFLKKGSLAGVEGRIQTG
SYEGQDGKRVYTTEVVADSVQFLEPKNANANTDRSQGQQPSYQQNQSPSPSQQNHTRVDEDPFSSGSGPIEVSDDDLPF
Nucleotide
Download Length: 480 bp
>NTDB_id=127048 PLANO_RS15155 WP_038705252.1 3089729..3090208(-) (ssbA) [Planococcus sp. PAMC 21323]
ATGATTAACCGAGTTGTTTTAGTCGGAAGACTGACAAAAGATCCAGACCTTCGTTACACACCAAGCGGCGCGGCAGTTGC
TCGTTTTACACTTGCTGTAAACCGGACATTCTCAAACGCTCAAGGTGAACGCGAAGCTGATTTCATTAATTGTACCGTTT
GGCGCAAACAAGCTGAAAATACAGCGAATTTCCTGAAAAAAGGAAGCTTAGCTGGTGTTGAAGGCCGTATCCAAACAGGT
AGCTACGAGGGACAAGACGGGAAACGCGTCTATACAACAGAAGTAGTGGCAGATAGTGTTCAATTTCTTGAGCCAAAAAA
TGCTAATGCTAATACGGACCGTTCACAAGGACAGCAGCCTTCGTATCAACAGAACCAATCACCGAGCCCAAGTCAGCAAA
ACCATACTCGTGTAGATGAAGATCCATTCTCAAGTGGTAGCGGCCCGATAGAAGTATCGGATGACGATTTACCGTTCTAA
ATGATTAACCGAGTTGTTTTAGTCGGAAGACTGACAAAAGATCCAGACCTTCGTTACACACCAAGCGGCGCGGCAGTTGC
TCGTTTTACACTTGCTGTAAACCGGACATTCTCAAACGCTCAAGGTGAACGCGAAGCTGATTTCATTAATTGTACCGTTT
GGCGCAAACAAGCTGAAAATACAGCGAATTTCCTGAAAAAAGGAAGCTTAGCTGGTGTTGAAGGCCGTATCCAAACAGGT
AGCTACGAGGGACAAGACGGGAAACGCGTCTATACAACAGAAGTAGTGGCAGATAGTGTTCAATTTCTTGAGCCAAAAAA
TGCTAATGCTAATACGGACCGTTCACAAGGACAGCAGCCTTCGTATCAACAGAACCAATCACCGAGCCCAAGTCAGCAAA
ACCATACTCGTGTAGATGAAGATCCATTCTCAAGTGGTAGCGGCCCGATAGAAGTATCGGATGACGATTTACCGTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
60.465 |
100 |
0.654 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.335 |
100 |
0.591 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
68.868 |
66.667 |
0.459 |
| ssb | Neisseria gonorrhoeae MS11 |
36.782 |
100 |
0.403 |
| ssb | Neisseria meningitidis MC58 |
36.047 |
100 |
0.39 |
| ssb | Vibrio cholerae strain A1552 |
33.333 |
100 |
0.377 |