Detailed information    

insolico Bioinformatically predicted

Overview


Name   vicR   Type   Regulator
Locus tag   DI45_RS02380 Genome accession   NZ_CP007560
Coordinates   449110..449820 (+) Length   236 a.a.
NCBI ID   WP_002985645.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain NGAS743     
Function   repress comCDE expression; repress comX expression (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 404335..474058 449110..449820 within 0


Gene organization within MGE regions


Location: 404335..474058
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DI45_RS10715 - 404544..404855 (+) 312 WP_227874480.1 CPBP family intramembrane glutamic endopeptidase -
  DI45_RS10580 - 404940..405068 (+) 129 WP_002994583.1 hypothetical protein -
  DI45_RS02145 (DI45_02225) - 405466..405693 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  DI45_RS02150 (DI45_02230) - 405742..406059 (+) 318 WP_002994587.1 hypothetical protein -
  DI45_RS10440 - 406179..407263 (+) 1085 Protein_377 IS3 family transposase -
  DI45_RS02170 (DI45_02250) - 407467..408865 (+) 1399 Protein_378 IS1182 family transposase -
  DI45_RS02175 (DI45_02255) comE/blpR 409113..409862 (+) 750 WP_002992578.1 response regulator transcription factor Regulator
  DI45_RS02180 (DI45_02260) - 409863..411197 (+) 1335 WP_047235191.1 sensor histidine kinase -
  DI45_RS09805 - 411345..411470 (-) 126 WP_011017462.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  DI45_RS02185 (DI45_02270) - 411547..412911 (-) 1365 WP_014635340.1 bacteriocin secretion accessory protein -
  DI45_RS02190 (DI45_02275) comA/nlmT 412922..415075 (-) 2154 WP_047235192.1 peptide cleavage/export ABC transporter Regulator
  DI45_RS02195 (DI45_02280) - 415362..415589 (+) 228 WP_002992018.1 Blp family class II bacteriocin -
  DI45_RS02200 (DI45_02285) - 415602..415802 (+) 201 WP_002985729.1 class IIb bacteriocin, lactobin A/cerein 7B family -
  DI45_RS10585 - 416164..416292 (+) 129 WP_002985724.1 hypothetical protein -
  DI45_RS02220 (DI45_02305) - 416818..417219 (+) 402 WP_047235194.1 hypothetical protein -
  DI45_RS02225 (DI45_02310) - 417470..418540 (+) 1071 WP_047235195.1 hypothetical protein -
  DI45_RS02230 (DI45_02315) - 418633..419031 (+) 399 WP_038433666.1 hypothetical protein -
  DI45_RS02235 (DI45_02320) stcA 419379..419648 (-) 270 WP_011017467.1 quorum-sensing system protein StcA -
  DI45_RS10280 (DI45_02330) - 420043..420222 (-) 180 WP_011184266.1 hypothetical protein -
  DI45_RS10635 - 420171..420413 (-) 243 WP_002985713.1 hypothetical protein -
  DI45_RS10210 shp2 420563..420631 (-) 69 WP_128650799.1 peptide pheromone SHP2 -
  DI45_RS02245 (DI45_02335) rgg2 420720..421586 (+) 867 WP_002990747.1 quorum-sensing system transcriptional regulator Rgg2 -
  DI45_RS02250 (DI45_02340) mutM 421758..422585 (+) 828 WP_002990742.1 DNA-formamidopyrimidine glycosylase -
  DI45_RS02255 (DI45_02345) coaE 422582..423175 (+) 594 WP_047235583.1 dephospho-CoA kinase -
  DI45_RS02260 (DI45_02350) - 423375..424877 (+) 1503 WP_047235196.1 helicase HerA-like domain-containing protein -
  DI45_RS02265 (DI45_02355) - 424999..426192 (+) 1194 WP_002994146.1 multidrug efflux MFS transporter -
  DI45_RS09815 rpmG 426189..426335 (+) 147 WP_002990729.1 50S ribosomal protein L33 -
  DI45_RS02270 (DI45_02360) secG 426381..426617 (+) 237 WP_047235197.1 preprotein translocase subunit SecG -
  DI45_RS02275 (DI45_02365) rnr 426711..429044 (+) 2334 WP_080342657.1 ribonuclease R -
  DI45_RS02280 (DI45_02370) smpB 429047..429514 (+) 468 WP_047235198.1 SsrA-binding protein SmpB -
  DI45_RS02285 (DI45_02375) - 429520..430239 (+) 720 WP_010921981.1 glutaminyl-peptide cyclotransferase -
  DI45_RS02290 (DI45_02380) pcp 430357..431004 (-) 648 WP_047235199.1 pyroglutamyl-peptidase I -
  DI45_RS02295 (DI45_02385) - 431054..431980 (-) 927 WP_011184272.1 DUF979 domain-containing protein -
  DI45_RS02300 (DI45_02390) - 431980..432663 (-) 684 WP_014635345.1 DUF969 domain-containing protein -
  DI45_RS02305 (DI45_02395) - 432874..433800 (-) 927 WP_002994177.1 glycosyltransferase family 2 protein -
  DI45_RS02310 (DI45_02400) - 433945..434322 (-) 378 WP_002985686.1 VOC family protein -
  DI45_RS02315 (DI45_02405) - 434333..434998 (-) 666 WP_002985684.1 NAD(P)H-dependent oxidoreductase -
  DI45_RS02320 (DI45_02410) - 435047..436132 (-) 1086 WP_011054264.1 aminopeptidase P family protein -
  DI45_RS02325 (DI45_02415) ccpA 436306..437307 (+) 1002 WP_002985680.1 catabolite control protein A Regulator
  DI45_RS02330 (DI45_02420) - 437438..438436 (+) 999 WP_002985678.1 glycosyltransferase family 4 protein -
  DI45_RS02335 (DI45_02425) - 438438..439772 (+) 1335 WP_002985676.1 glycosyltransferase family 4 protein -
  DI45_RS02340 (DI45_02435) thrS 440194..442137 (+) 1944 WP_047235200.1 threonine--tRNA ligase -
  DI45_RS02345 (DI45_02440) - 442278..443270 (+) 993 WP_011017482.1 ATP-binding cassette domain-containing protein -
  DI45_RS02350 (DI45_02445) - 443272..444090 (+) 819 WP_047235201.1 ABC transporter permease -
  DI45_RS02355 (DI45_02450) - 444092..444877 (+) 786 WP_002985667.1 ABC transporter permease -
  DI45_RS02360 (DI45_02455) - 444962..445111 (+) 150 WP_011285429.1 hypothetical protein -
  DI45_RS02365 (DI45_02460) - 445506..446654 (+) 1149 WP_047235202.1 acetyl-CoA C-acyltransferase -
  DI45_RS02370 (DI45_02465) - 446611..447858 (+) 1248 WP_047235203.1 AMP-binding protein -
  DI45_RS02375 (DI45_02470) - 447914..448948 (+) 1035 WP_174147118.1 DUF3114 domain-containing protein -
  DI45_RS02380 (DI45_02475) vicR 449110..449820 (+) 711 WP_002985645.1 response regulator YycF Regulator
  DI45_RS02385 (DI45_02480) vicK 449813..451165 (+) 1353 WP_014407395.1 cell wall metabolism sensor histidine kinase VicK Regulator
  DI45_RS02390 (DI45_02485) vicX 451169..451978 (+) 810 WP_023612763.1 MBL fold metallo-hydrolase Regulator
  DI45_RS02395 (DI45_02490) rnc 452397..453089 (+) 693 WP_002990670.1 ribonuclease III -
  DI45_RS02400 (DI45_02495) smc 453090..456629 (+) 3540 WP_047235204.1 chromosome segregation protein SMC -
  DI45_RS02405 (DI45_02500) rgg3 456882..457733 (-) 852 WP_002985634.1 quorum-sensing system transcriptional regulator Rgg3 -
  DI45_RS10215 shp3 457813..457884 (+) 72 WP_128650800.1 peptide pheromone SHP3 -
  DI45_RS02410 (DI45_02505) - 457953..458879 (+) 927 WP_020833336.1 shikimate dehydrogenase -
  DI45_RS02415 (DI45_02510) - 458876..459712 (+) 837 WP_002985631.1 sugar phosphate isomerase/epimerase family protein -
  DI45_RS02420 (DI45_02515) cofE 459714..460448 (+) 735 WP_002994761.1 coenzyme F420-0:L-glutamate ligase -
  DI45_RS02425 (DI45_02520) - 460441..461427 (+) 987 WP_009880286.1 dehydrogenase -
  DI45_RS02430 (DI45_02525) - 461437..462636 (+) 1200 WP_002985626.1 methionine adenosyltransferase -
  DI45_RS02435 (DI45_02530) - 462620..463588 (+) 969 WP_002985624.1 serine kinase -
  DI45_RS02440 (DI45_02535) - 463643..464632 (+) 990 WP_009880288.1 glycosyltransferase family 2 protein -
  DI45_RS02450 (DI45_02545) - 465324..466481 (+) 1158 WP_009880289.1 nucleotide sugar dehydrogenase -
  DI45_RS02455 (DI45_02550) - 466566..467774 (+) 1209 WP_032464248.1 MFS transporter -
  DI45_RS02460 (DI45_02555) - 467877..468086 (-) 210 WP_002985621.1 helix-turn-helix domain-containing protein -
  DI45_RS02470 (DI45_02565) - 468067..469734 (-) 1668 Protein_439 DUF2326 domain-containing protein -
  DI45_RS02475 (DI45_02570) - 469725..469949 (-) 225 WP_001176803.1 ABC-three component system middle component 7 -
  DI45_RS02480 (DI45_02575) - 469949..470842 (-) 894 WP_080342658.1 ABC-three component system protein -
  DI45_RS09820 - 470777..471034 (+) 258 WP_229699512.1 terminase TerL endonuclease subunit -
  DI45_RS02485 (DI45_02580) - 471089..471391 (+) 303 WP_002991611.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
  DI45_RS02490 (DI45_02585) - 471391..471696 (+) 306 Protein_444 type II toxin-antitoxin system RelE/ParE family toxin -
  DI45_RS02495 (DI45_02590) - 471715..471987 (+) 273 WP_002985604.1 hypothetical protein -
  DI45_RS10445 - 472092..472226 (+) 135 Protein_446 portal protein -

Sequence


Protein


Download         Length: 236 a.a.        Molecular weight: 27083.99 Da        Isoelectric Point: 4.9038

>NTDB_id=120834 DI45_RS02380 WP_002985645.1 449110..449820(+) (vicR) [Streptococcus pyogenes strain NGAS743]
MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEKPDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVE
LTHREFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMKSYD

Nucleotide


Download         Length: 711 bp        

>NTDB_id=120834 DI45_RS02380 WP_002985645.1 449110..449820(+) (vicR) [Streptococcus pyogenes strain NGAS743]
ATGAAAAAAATACTTATTGTGGATGATGAAAAACCGATTTCTGACATTATTAAGTTTAATTTGACAAAAGAAGGTTATGA
CATTGTTACAGCTTTTGATGGACGCGAAGCGGTAACCATTTTTGAAGAAGAAAAGCCAGATTTAATTATTCTTGATTTGA
TGCTCCCTGAGTTGGACGGTCTTGAAGTAGCCAAGGAAATTCGTAAAACCAGTCATGTCCCGATTATTATGTTGTCGGCT
AAAGATAGTGAGTTTGACAAGGTTATTGGACTTGAAATTGGGGCTGATGATTACGTGACCAAGCCCTTTTCTAATCGGGA
ATTGCTGGCGCGTGTCAAGGCTCATCTGCGTCGTACCGAAACTATTGAAACGGCTGTTGCAGAAGAAAATGCTTCTTCAG
GTACACAGGAACTGACCATTGGTAATTTACAGATTTTACCAGATGCGTTTGTTGCTAAAAAACATGGTCAAGAGGTAGAG
TTGACCCATCGTGAATTTGAACTATTGCATCATCTAGCTAACCATATGGGGCAGGTGATGACACGAGAACACTTATTGGA
AATTGTTTGGGGATATGATTATTTTGGCGATGTGCGCACGGTTGATGTGACTGTTCGTCGTCTCCGTGAAAAAATTGAAG
ACACACCAAGTCGTCCTGAGTATATTTTAACAAGACGTGGTGTTGGGTACTACATGAAATCTTATGACTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vicR Streptococcus mutans UA159

90.254

100

0.903

  micA Streptococcus pneumoniae Cp1015

79.06

99.153

0.784

  covR Streptococcus salivarius strain HSISS4

44.828

98.305

0.441

  covR Lactococcus lactis subsp. lactis strain DGCC12653

44.397

98.305

0.436

  scnR Streptococcus mutans UA159

36.91

98.729

0.364


Multiple sequence alignment