Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | ACLV7D_RS10265 | Genome accession | NZ_OZ217345 |
| Coordinates | 2157568..2157693 (-) | Length | 41 a.a. |
| NCBI ID | WP_112445417.1 | Uniprot ID | - |
| Organism | Streptococcus mitis isolate S. mitis F22 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2152568..2162693
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLV7D_RS10240 (SMIF22_20320) | - | 2154688..2155230 (+) | 543 | WP_119941849.1 | TetR/AcrR family transcriptional regulator | - |
| ACLV7D_RS10255 (SMIF22_20350) | comE | 2155473..2156225 (-) | 753 | WP_000866064.1 | competence system response regulator transcription factor ComE | Regulator |
| ACLV7D_RS10260 (SMIF22_20360) | comD/comD2 | 2156222..2157547 (-) | 1326 | WP_164226121.1 | competence system sensor histidine kinase ComD | Regulator |
| ACLV7D_RS10265 (SMIF22_20370) | comC/comC2 | 2157568..2157693 (-) | 126 | WP_112445417.1 | competence-stimulating peptide ComC | Regulator |
| ACLV7D_RS10275 (SMIF22_20390) | rlmH | 2157976..2158455 (-) | 480 | WP_112445415.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACLV7D_RS10280 (SMIF22_20400) | htrA | 2158639..2159820 (+) | 1182 | WP_112445413.1 | S1C family serine protease | Regulator |
| ACLV7D_RS10285 (SMIF22_20410) | spo0J | 2159878..2160636 (+) | 759 | WP_164226120.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4877.81 Da Isoelectric Point: 10.7785
>NTDB_id=1170405 ACLV7D_RS10265 WP_112445417.1 2157568..2157693(-) (comC/comC2) [Streptococcus mitis isolate S. mitis F22]
MKNTVKLEQFVALKEKDLQEIRGGESRVSRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQEIRGGESRVSRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=1170405 ACLV7D_RS10265 WP_112445417.1 2157568..2157693(-) (comC/comC2) [Streptococcus mitis isolate S. mitis F22]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTCGAGGTGGGGAAAGTAG
GGTTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCCTTGAAGGAAAAAGACTTGCAGGAGATTCGAGGTGGGGAAAGTAG
GGTTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
90.244 |
100 |
0.902 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
90.244 |
100 |
0.902 |
| comC | Streptococcus mitis SK321 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae R6 |
73.171 |
100 |
0.732 |
| comC/comC1 | Streptococcus pneumoniae G54 |
73.171 |
100 |
0.732 |
| comC/comC1 | Streptococcus pneumoniae D39 |
73.171 |
100 |
0.732 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
73.171 |
100 |
0.732 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |