Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QOR61_RS09670 | Genome accession | NZ_OX460960 |
| Coordinates | 1866035..1866547 (-) | Length | 170 a.a. |
| NCBI ID | WP_283572548.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae isolate MRI Z2-299 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1835435..1874866 | 1866035..1866547 | within | 0 |
Gene organization within MGE regions
Location: 1835435..1874866
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOR61_RS09445 | - | 1835435..1836154 (-) | 720 | WP_283572506.1 | peptidoglycan amidohydrolase family protein | - |
| QOR61_RS09450 | - | 1836157..1836393 (-) | 237 | WP_283572507.1 | phage holin | - |
| QOR61_RS09455 | - | 1836396..1836719 (-) | 324 | WP_283572508.1 | hypothetical protein | - |
| QOR61_RS09460 | - | 1836731..1836847 (-) | 117 | WP_283572509.1 | CD1375 family protein | - |
| QOR61_RS09465 | - | 1836870..1837247 (-) | 378 | WP_283572510.1 | DUF1366 domain-containing protein | - |
| QOR61_RS09470 | - | 1837257..1839284 (-) | 2028 | WP_283572511.1 | DUF859 family phage minor structural protein | - |
| QOR61_RS09475 | - | 1839296..1842700 (-) | 3405 | WP_283572512.1 | hypothetical protein | - |
| QOR61_RS09480 | - | 1842700..1844148 (-) | 1449 | WP_283572513.1 | distal tail protein Dit | - |
| QOR61_RS09485 | - | 1844145..1847951 (-) | 3807 | WP_283572514.1 | tape measure protein | - |
| QOR61_RS09490 | - | 1847971..1848558 (-) | 588 | WP_283572515.1 | Gp15 family bacteriophage protein | - |
| QOR61_RS09495 | - | 1848561..1848959 (-) | 399 | WP_283572516.1 | hypothetical protein | - |
| QOR61_RS09500 | - | 1848984..1849439 (-) | 456 | WP_283572517.1 | phage tail protein | - |
| QOR61_RS09505 | - | 1849442..1849849 (-) | 408 | WP_283572518.1 | minor capsid protein | - |
| QOR61_RS09510 | - | 1849850..1850206 (-) | 357 | WP_283572519.1 | minor capsid protein | - |
| QOR61_RS09515 | - | 1850206..1850532 (-) | 327 | WP_283572520.1 | putative minor capsid protein | - |
| QOR61_RS09520 | - | 1850522..1850911 (-) | 390 | WP_283572521.1 | hypothetical protein | - |
| QOR61_RS09525 | - | 1850952..1851194 (-) | 243 | WP_283572522.1 | hypothetical protein | - |
| QOR61_RS09530 | - | 1851206..1852090 (-) | 885 | WP_283572523.1 | phage capsid protein | - |
| QOR61_RS09535 | - | 1852113..1852691 (-) | 579 | WP_283572524.1 | phage scaffolding protein | - |
| QOR61_RS09540 | - | 1852829..1853998 (-) | 1170 | WP_283572525.1 | phage minor capsid protein | - |
| QOR61_RS09545 | - | 1854097..1854357 (-) | 261 | WP_070030351.1 | hypothetical protein | - |
| QOR61_RS09550 | - | 1854329..1855912 (-) | 1584 | WP_283572526.1 | phage portal protein | - |
| QOR61_RS09555 | - | 1855924..1857237 (-) | 1314 | WP_283572527.1 | PBSX family phage terminase large subunit | - |
| QOR61_RS09560 | - | 1857224..1857667 (-) | 444 | WP_283572528.1 | stress-induced protein | - |
| QOR61_RS09565 | - | 1857766..1858164 (-) | 399 | WP_283572529.1 | hypothetical protein | - |
| QOR61_RS09570 | - | 1858140..1859246 (-) | 1107 | WP_283572530.1 | DUF4417 domain-containing protein | - |
| QOR61_RS09575 | - | 1859330..1859572 (-) | 243 | WP_283572531.1 | hypothetical protein | - |
| QOR61_RS09580 | - | 1859629..1860009 (-) | 381 | WP_283572532.1 | hypothetical protein | - |
| QOR61_RS09585 | - | 1859996..1860175 (-) | 180 | WP_283572533.1 | hypothetical protein | - |
| QOR61_RS09590 | - | 1860211..1860513 (-) | 303 | WP_283572534.1 | DUF6275 family protein | - |
| QOR61_RS09595 | - | 1860510..1860728 (-) | 219 | WP_283572535.1 | hypothetical protein | - |
| QOR61_RS09600 | - | 1860730..1861113 (-) | 384 | WP_283572536.1 | YopX family protein | - |
| QOR61_RS09605 | - | 1861106..1861291 (-) | 186 | WP_283572537.1 | hypothetical protein | - |
| QOR61_RS09610 | - | 1861288..1861683 (-) | 396 | WP_283572538.1 | hypothetical protein | - |
| QOR61_RS09615 | - | 1861673..1862182 (-) | 510 | WP_283572539.1 | DUF1642 domain-containing protein | - |
| QOR61_RS09620 | - | 1862175..1862414 (-) | 240 | WP_283572540.1 | hypothetical protein | - |
| QOR61_RS09625 | - | 1862487..1862735 (-) | 249 | WP_283572541.1 | hypothetical protein | - |
| QOR61_RS09630 | - | 1862722..1863207 (-) | 486 | WP_283572542.1 | class I SAM-dependent methyltransferase | - |
| QOR61_RS09635 | - | 1863194..1863418 (-) | 225 | WP_283572543.1 | hypothetical protein | - |
| QOR61_RS09640 | - | 1863418..1863744 (-) | 327 | WP_283572544.1 | DUF1372 family protein | - |
| QOR61_RS09645 | - | 1863914..1864087 (-) | 174 | WP_176724768.1 | hypothetical protein | - |
| QOR61_RS09650 | - | 1864087..1864335 (-) | 249 | WP_283572545.1 | hypothetical protein | - |
| QOR61_RS09655 | - | 1864388..1865122 (-) | 735 | WP_283572546.1 | hypothetical protein | - |
| QOR61_RS09660 | - | 1865124..1865546 (-) | 423 | WP_070030336.1 | hypothetical protein | - |
| QOR61_RS09665 | - | 1865539..1866021 (-) | 483 | WP_283572547.1 | helix-turn-helix transcriptional regulator | - |
| QOR61_RS09670 | ssbA | 1866035..1866547 (-) | 513 | WP_283572548.1 | single-stranded DNA-binding protein | Machinery gene |
| QOR61_RS09675 | - | 1866540..1866722 (-) | 183 | WP_283572549.1 | hypothetical protein | - |
| QOR61_RS09680 | - | 1866719..1867252 (-) | 534 | WP_070030332.1 | MazG-like family protein | - |
| QOR61_RS09685 | - | 1867254..1868285 (-) | 1032 | WP_283572550.1 | DUF1351 domain-containing protein | - |
| QOR61_RS09690 | - | 1868301..1869029 (-) | 729 | WP_283572551.1 | ERF family protein | - |
| QOR61_RS09695 | - | 1869035..1869310 (-) | 276 | WP_283572552.1 | hypothetical protein | - |
| QOR61_RS09700 | - | 1869303..1870244 (-) | 942 | WP_283572553.1 | DnaD domain protein | - |
| QOR61_RS09705 | - | 1870241..1870519 (-) | 279 | WP_283572554.1 | hypothetical protein | - |
| QOR61_RS09710 | - | 1870742..1870918 (-) | 177 | WP_176724766.1 | hypothetical protein | - |
| QOR61_RS09715 | - | 1870964..1871179 (-) | 216 | WP_283572555.1 | helix-turn-helix transcriptional regulator | - |
| QOR61_RS09720 | - | 1871364..1872119 (+) | 756 | WP_283572556.1 | XRE family transcriptional regulator | - |
| QOR61_RS09725 | - | 1872124..1872306 (+) | 183 | WP_283572557.1 | hypothetical protein | - |
| QOR61_RS09730 | - | 1872308..1872898 (+) | 591 | WP_283572558.1 | sporulation protein | - |
| QOR61_RS09735 | - | 1872923..1873330 (+) | 408 | WP_283572559.1 | hypothetical protein | - |
| QOR61_RS09740 | - | 1873335..1873652 (+) | 318 | WP_283572560.1 | hypothetical protein | - |
| QOR61_RS09745 | - | 1873775..1874866 (+) | 1092 | WP_283572561.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 170 a.a. Molecular weight: 19318.17 Da Isoelectric Point: 4.9007
>NTDB_id=1159329 QOR61_RS09670 WP_283572548.1 1866035..1866547(-) (ssbA) [Streptococcus agalactiae isolate MRI Z2-299]
MINNVVLVGRLTKDAELRYTPSQVAVATFTLAVNRRFKEQNGEREADFINCVIWQKSAENLANWCKKGSLIGITGRIQTR
NYENQQGQRVYVTEVVAESFQLLESRKDNNQGAPQNNQGYQQPNNNYQQPQNNQSYQQQSSQGFNQGQQGSFFDGMTTNP
VDISDDDLPF
MINNVVLVGRLTKDAELRYTPSQVAVATFTLAVNRRFKEQNGEREADFINCVIWQKSAENLANWCKKGSLIGITGRIQTR
NYENQQGQRVYVTEVVAESFQLLESRKDNNQGAPQNNQGYQQPNNNYQQPQNNQSYQQQSSQGFNQGQQGSFFDGMTTNP
VDISDDDLPF
Nucleotide
Download Length: 513 bp
>NTDB_id=1159329 QOR61_RS09670 WP_283572548.1 1866035..1866547(-) (ssbA) [Streptococcus agalactiae isolate MRI Z2-299]
ATGATTAATAACGTTGTTTTAGTTGGTCGATTGACCAAGGATGCAGAGTTGCGATATACACCAAGTCAGGTAGCAGTTGC
AACATTCACATTGGCGGTTAATCGTCGATTTAAAGAGCAAAATGGTGAACGTGAGGCAGACTTTATCAACTGTGTTATAT
GGCAAAAATCGGCTGAAAATCTAGCAAATTGGTGTAAAAAAGGTTCTTTAATCGGCATCACAGGTCGTATCCAAACTCGA
AACTATGAAAATCAACAGGGTCAGCGAGTTTATGTAACTGAGGTGGTTGCTGAGTCTTTTCAATTGCTTGAGAGCCGAAA
AGATAACAACCAAGGAGCACCTCAGAATAATCAAGGTTATCAACAACCTAATAATAATTATCAACAACCACAAAATAACC
AAAGTTATCAACAACAAAGCAGTCAAGGGTTTAACCAAGGTCAGCAAGGCAGTTTCTTTGATGGCATGACTACAAATCCA
GTTGACATCTCGGATGATGATTTACCTTTCTAA
ATGATTAATAACGTTGTTTTAGTTGGTCGATTGACCAAGGATGCAGAGTTGCGATATACACCAAGTCAGGTAGCAGTTGC
AACATTCACATTGGCGGTTAATCGTCGATTTAAAGAGCAAAATGGTGAACGTGAGGCAGACTTTATCAACTGTGTTATAT
GGCAAAAATCGGCTGAAAATCTAGCAAATTGGTGTAAAAAAGGTTCTTTAATCGGCATCACAGGTCGTATCCAAACTCGA
AACTATGAAAATCAACAGGGTCAGCGAGTTTATGTAACTGAGGTGGTTGCTGAGTCTTTTCAATTGCTTGAGAGCCGAAA
AGATAACAACCAAGGAGCACCTCAGAATAATCAAGGTTATCAACAACCTAATAATAATTATCAACAACCACAAAATAACC
AAAGTTATCAACAACAAAGCAGTCAAGGGTTTAACCAAGGTCAGCAAGGCAGTTTCTTTGATGGCATGACTACAAATCCA
GTTGACATCTCGGATGATGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.195 |
100 |
0.606 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.062 |
100 |
0.594 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
54.622 |
70 |
0.382 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
62.353 |
0.365 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
52.991 |
68.824 |
0.365 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
52.991 |
68.824 |
0.365 |