Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KJP45_RS12240 Genome accession   NZ_OX419578
Coordinates   2391741..2392115 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis isolate NRS6128     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2386741..2397115
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP45_RS12200 (NRS6128_12105) yqhG 2387073..2387867 (+) 795 WP_003230200.1 YqhG family protein -
  KJP45_RS12205 (NRS6128_12110) sinI 2388050..2388223 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP45_RS12210 (NRS6128_12115) sinR 2388257..2388592 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP45_RS12215 (NRS6128_12120) tasA 2388685..2389470 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KJP45_RS12220 (NRS6128_12125) sipW 2389534..2390106 (-) 573 WP_003230181.1 signal peptidase I -
  KJP45_RS12225 (NRS6128_12130) tapA 2390090..2390851 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP45_RS12230 (NRS6128_12135) yqzG 2391123..2391449 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  KJP45_RS12235 (NRS6128_12140) spoIIT 2391491..2391670 (-) 180 WP_213414620.1 YqzE family protein -
  KJP45_RS12240 (NRS6128_12145) comGG 2391741..2392115 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KJP45_RS12245 comGF 2392116..2392499 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  KJP45_RS12250 (NRS6128_12155) comGE 2392525..2392872 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  KJP45_RS12255 (NRS6128_12160) comGD 2392856..2393287 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  KJP45_RS12260 (NRS6128_12165) comGC 2393277..2393573 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP45_RS12265 (NRS6128_12170) comGB 2393587..2394624 (-) 1038 WP_213414619.1 comG operon protein ComGB Machinery gene
  KJP45_RS12270 (NRS6128_12175) comGA 2394611..2395681 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP45_RS12275 (NRS6128_12180) - 2395893..2396090 (-) 198 WP_213414618.1 hypothetical protein -
  KJP45_RS12280 (NRS6128_12185) corA 2396092..2397045 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=1157828 KJP45_RS12240 WP_014480253.1 2391741..2392115(-) (comGG) [Bacillus subtilis isolate NRS6128]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1157828 KJP45_RS12240 WP_014480253.1 2391741..2392115(-) (comGG) [Bacillus subtilis isolate NRS6128]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment