Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP45_RS12205 Genome accession   NZ_OX419578
Coordinates   2388050..2388223 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate NRS6128     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2383050..2393223
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP45_RS12190 (NRS6128_12095) gcvT 2383850..2384938 (-) 1089 WP_080529534.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP45_RS12195 (NRS6128_12100) yqhH 2385379..2387052 (+) 1674 WP_003230203.1 SNF2-related protein -
  KJP45_RS12200 (NRS6128_12105) yqhG 2387073..2387867 (+) 795 WP_003230200.1 YqhG family protein -
  KJP45_RS12205 (NRS6128_12110) sinI 2388050..2388223 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP45_RS12210 (NRS6128_12115) sinR 2388257..2388592 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP45_RS12215 (NRS6128_12120) tasA 2388685..2389470 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KJP45_RS12220 (NRS6128_12125) sipW 2389534..2390106 (-) 573 WP_003230181.1 signal peptidase I -
  KJP45_RS12225 (NRS6128_12130) tapA 2390090..2390851 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  KJP45_RS12230 (NRS6128_12135) yqzG 2391123..2391449 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  KJP45_RS12235 (NRS6128_12140) spoIIT 2391491..2391670 (-) 180 WP_213414620.1 YqzE family protein -
  KJP45_RS12240 (NRS6128_12145) comGG 2391741..2392115 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  KJP45_RS12245 comGF 2392116..2392499 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  KJP45_RS12250 (NRS6128_12155) comGE 2392525..2392872 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1157826 KJP45_RS12205 WP_003230187.1 2388050..2388223(+) (sinI) [Bacillus subtilis isolate NRS6128]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1157826 KJP45_RS12205 WP_003230187.1 2388050..2388223(+) (sinI) [Bacillus subtilis isolate NRS6128]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment