Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STN4L_RS10530 | Genome accession | NZ_LS974444 |
| Coordinates | 1117610..1117819 (-) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain N4L | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1112610..1122819
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STN4L_RS05785 (STN4L_01343) | - | 1113608..1113919 (-) | 312 | WP_002886559.1 | urease subunit beta | - |
| STN4L_RS05790 (STN4L_01344) | - | 1113931..1114233 (-) | 303 | WP_113870434.1 | urease subunit gamma | - |
| STN4L_RS05795 (STN4L_01345) | - | 1114258..1114773 (-) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STN4L_RS10515 (STN4L_01346) | - | 1115178..1115549 (+) | 372 | WP_224103195.1 | hypothetical protein | - |
| STN4L_RS10520 (STN4L_01349) | - | 1115773..1116075 (+) | 303 | WP_231910735.1 | hypothetical protein | - |
| STN4L_RS10525 | - | 1116315..1116599 (+) | 285 | WP_014727318.1 | hypothetical protein | - |
| STN4L_RS05805 (STN4L_01350) | - | 1116562..1116879 (-) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STN4L_RS05810 (STN4L_01351) | - | 1116987..1117555 (-) | 569 | Protein_1114 | ATP-binding cassette domain-containing protein | - |
| STN4L_RS10530 (STN4L_01353) | comA | 1117610..1117819 (-) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STN4L_RS10535 | - | 1117892..1118557 (-) | 666 | Protein_1116 | ABC transporter transmembrane domain-containing protein | - |
| STN4L_RS10540 | - | 1118587..1119081 (-) | 495 | Protein_1117 | cysteine peptidase family C39 domain-containing protein | - |
| STN4L_RS05835 (STN4L_01358) | comR | 1119256..1120155 (-) | 900 | WP_113870435.1 | helix-turn-helix domain-containing protein | Regulator |
| STN4L_RS05840 (STN4L_01359) | - | 1120350..1121000 (-) | 651 | WP_113870436.1 | phosphatase PAP2 family protein | - |
| STN4L_RS05845 (STN4L_01360) | - | 1121003..1121560 (-) | 558 | WP_011680718.1 | ECF transporter S component | - |
| STN4L_RS05850 (STN4L_01361) | - | 1121871..1122410 (-) | 540 | WP_372585740.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=1143064 STN4L_RS10530 WP_002946147.1 1117610..1117819(-) (comA) [Streptococcus thermophilus strain N4L]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1143064 STN4L_RS10530 WP_002946147.1 1117610..1117819(-) (comA) [Streptococcus thermophilus strain N4L]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |