Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | T303_RS11375 | Genome accession | NZ_CP006819 |
| Coordinates | 447193..447402 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus ASCC 1275 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 442193..452402
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| T303_RS02490 (T303_02535) | - | 442632..443141 (+) | 510 | WP_024704182.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| T303_RS02495 (T303_02540) | - | 443452..444009 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| T303_RS02500 (T303_02545) | - | 444012..444662 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| T303_RS02505 (T303_02550) | comR | 444857..445756 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| T303_RS11365 | - | 445994..446425 (+) | 432 | Protein_438 | cysteine peptidase family C39 domain-containing protein | - |
| T303_RS11370 | - | 446455..447171 (+) | 717 | Protein_439 | ABC transporter transmembrane domain-containing protein | - |
| T303_RS11375 | comA | 447193..447402 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| T303_RS02530 | - | 447457..448025 (+) | 569 | Protein_441 | ATP-binding cassette domain-containing protein | - |
| T303_RS02535 (T303_02560) | - | 448133..448465 (+) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| T303_RS11380 | - | 448611..449090 (-) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| T303_RS11385 (T303_02570) | - | 449532..449903 (-) | 372 | WP_224107488.1 | hypothetical protein | - |
| T303_RS02545 (T303_02575) | - | 450308..450823 (+) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| T303_RS02550 (T303_02580) | - | 450848..451150 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| T303_RS02555 (T303_02585) | - | 451162..451473 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=114116 T303_RS11375 WP_002946147.1 447193..447402(+) (comA) [Streptococcus thermophilus ASCC 1275]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=114116 T303_RS11375 WP_002946147.1 447193..447402(+) (comA) [Streptococcus thermophilus ASCC 1275]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |