Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | H1W74_RS09530 | Genome accession | NZ_LR822031 |
| Coordinates | 261396..261605 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1047 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 256396..266605
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W74_RS01380 (STHERMO_0291) | - | 256804..257343 (+) | 540 | WP_371851917.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| H1W74_RS01385 (STHERMO_0292) | - | 257654..258211 (+) | 558 | WP_002946140.1 | ECF transporter S component | - |
| H1W74_RS01390 (STHERMO_0293) | - | 258214..258864 (+) | 651 | WP_022096567.1 | phosphatase PAP2 family protein | - |
| H1W74_RS01395 (STHERMO_0295) | comR | 259059..259958 (+) | 900 | WP_002946143.1 | helix-turn-helix domain-containing protein | Regulator |
| H1W74_RS09525 | - | 260196..261374 (+) | 1179 | Protein_237 | ABC transporter transmembrane domain-containing protein | - |
| H1W74_RS09530 (STHERMO_0299) | comA | 261396..261605 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| H1W74_RS01420 (STHERMO_0301) | - | 261660..262228 (+) | 569 | Protein_239 | ATP-binding cassette domain-containing protein | - |
| H1W74_RS01425 (STHERMO_0302) | - | 262336..262647 (+) | 312 | WP_022096570.1 | DUF805 domain-containing protein | - |
| H1W74_RS09540 | - | 262868..263215 (-) | 348 | WP_232089310.1 | DUF4173 domain-containing protein | - |
| H1W74_RS09545 (STHERMO_0305) | - | 263140..264036 (-) | 897 | WP_224103642.1 | urease cluster protein | - |
| H1W74_RS01435 (STHERMO_0306) | - | 264441..264956 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| H1W74_RS01440 (STHERMO_0307) | - | 264981..265283 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| H1W74_RS01445 (STHERMO_0308) | - | 265295..265606 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=1131553 H1W74_RS09530 WP_002946147.1 261396..261605(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1047]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=1131553 H1W74_RS09530 WP_002946147.1 261396..261605(+) (comA) [Streptococcus thermophilus isolate STH_CIRM_1047]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |