Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   EL099_RS05745 Genome accession   NZ_LR134271
Coordinates   1123588..1124007 (+) Length   139 a.a.
NCBI ID   WP_000934796.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NCTC7988     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1109609..1158849 1123588..1124007 within 0


Gene organization within MGE regions


Location: 1109609..1158849
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL099_RS05625 (NCTC7988_01062) - 1109609..1110538 (-) 930 WP_000757587.1 glycerophosphodiester phosphodiesterase -
  EL099_RS05630 (NCTC7988_01063) - 1110777..1111031 (+) 255 WP_001049150.1 YlbG family protein -
  EL099_RS05635 (NCTC7988_01064) - 1111034..1111423 (-) 390 WP_000814565.1 DUF7147 family protein -
  EL099_RS05640 (NCTC7988_01065) rsmD 1111493..1112035 (+) 543 WP_001263794.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  EL099_RS05645 (NCTC7988_01066) coaD 1112037..1112519 (+) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  EL099_RS05650 (NCTC7988_01067) - 1112581..1113720 (-) 1140 WP_000843605.1 nucleotidyltransferase -
  EL099_RS05655 (NCTC7988_01068) - 1113847..1114404 (+) 558 WP_000872155.1 YceD family protein -
  EL099_RS05665 (NCTC7988_01069) rpmF 1114484..1114657 (+) 174 WP_000290472.1 50S ribosomal protein L32 -
  EL099_RS05670 (NCTC7988_01070) - 1114774..1116159 (-) 1386 WP_000861307.1 recombinase family protein -
  EL099_RS05675 (NCTC7988_01071) - 1116367..1117047 (-) 681 WP_069993724.1 type II toxin-antitoxin system PemK/MazF family toxin -
  EL099_RS05680 (NCTC7988_01072) - 1117079..1117804 (-) 726 WP_126525391.1 PH domain-containing protein -
  EL099_RS05685 (NCTC7988_01073) - 1117822..1118523 (-) 702 WP_076692361.1 XRE family transcriptional regulator -
  EL099_RS05690 (NCTC7988_01074) - 1118719..1118934 (+) 216 WP_000957143.1 hypothetical protein -
  EL099_RS14825 (NCTC7988_01075) - 1118950..1119117 (+) 168 WP_015977683.1 hypothetical protein -
  EL099_RS05695 (NCTC7988_01076) - 1119168..1119650 (-) 483 WP_015977661.1 hypothetical protein -
  EL099_RS05700 (NCTC7988_01077) - 1120096..1120281 (+) 186 WP_126525393.1 helix-turn-helix domain-containing protein -
  EL099_RS05705 (NCTC7988_01078) - 1120283..1121074 (+) 792 WP_001148575.1 phage antirepressor -
  EL099_RS05710 (NCTC7988_01079) tscA 1121075..1121299 (+) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  EL099_RS05715 (NCTC7988_01081) - 1121490..1121720 (-) 231 WP_000395455.1 hypothetical protein -
  EL099_RS14830 (NCTC7988_01082) - 1121780..1121917 (+) 138 WP_001568566.1 hypothetical protein -
  EL099_RS05720 (NCTC7988_01083) - 1121901..1122068 (+) 168 WP_045178556.1 DUF1270 domain-containing protein -
  EL099_RS05725 (NCTC7988_01084) - 1122069..1122389 (+) 321 WP_000219664.1 hypothetical protein -
  EL099_RS05730 (NCTC7988_01085) - 1122481..1122741 (+) 261 WP_000291090.1 DUF1108 family protein -
  EL099_RS05735 (NCTC7988_01086) - 1122751..1122972 (+) 222 WP_000815401.1 DUF2483 family protein -
  EL099_RS05740 (NCTC7988_01087) - 1122965..1123588 (+) 624 WP_000139727.1 DUF1071 domain-containing protein -
  EL099_RS05745 (NCTC7988_01088) ssbA 1123588..1124007 (+) 420 WP_000934796.1 single-stranded DNA-binding protein Machinery gene
  EL099_RS05750 (NCTC7988_01089) - 1124021..1124695 (+) 675 WP_126525394.1 putative HNHc nuclease -
  EL099_RS05755 (NCTC7988_01090) - 1124688..1125452 (+) 765 WP_058332265.1 DnaD domain protein -
  EL099_RS05760 (NCTC7988_01091) - 1125452..1125808 (+) 357 WP_001132243.1 hypothetical protein -
  EL099_RS05765 (NCTC7988_01092) - 1125805..1127046 (+) 1242 WP_126525396.1 DnaB helicase C-terminal domain-containing protein -
  EL099_RS05770 (NCTC7988_01093) - 1127043..1127258 (+) 216 WP_061731561.1 hypothetical protein -
  EL099_RS05775 (NCTC7988_01094) - 1127262..1127483 (+) 222 WP_001123690.1 DUF3269 family protein -
  EL099_RS05780 (NCTC7988_01095) - 1127494..1127898 (+) 405 WP_015977666.1 DUF1064 domain-containing protein -
  EL099_RS05785 (NCTC7988_01096) - 1127903..1128088 (+) 186 WP_001187244.1 DUF3113 family protein -
  EL099_RS05790 (NCTC7988_01097) - 1128089..1128394 (+) 306 WP_001074144.1 hypothetical protein -
  EL099_RS05795 (NCTC7988_01098) - 1128522..1128881 (+) 360 WP_061735298.1 SA1788 family PVL leukocidin-associated protein -
  EL099_RS05800 (NCTC7988_01099) - 1128882..1129130 (+) 249 WP_126525398.1 phi PVL orf 51-like protein -
  EL099_RS05805 (NCTC7988_01100) - 1129144..1129554 (+) 411 WP_000695750.1 hypothetical protein -
  EL099_RS05810 (NCTC7988_01101) - 1129554..1129829 (+) 276 WP_000399884.1 hypothetical protein -
  EL099_RS05815 (NCTC7988_01102) - 1129822..1130070 (+) 249 WP_001065080.1 DUF1024 family protein -
  EL099_RS05820 (NCTC7988_01103) - 1130063..1130575 (+) 513 WP_126525400.1 dUTP diphosphatase -
  EL099_RS05825 (NCTC7988_01104) - 1130642..1130929 (+) 288 WP_126525402.1 DUF1381 domain-containing protein -
  EL099_RS05830 (NCTC7988_01105) - 1130922..1131158 (+) 237 WP_000608278.1 DUF7366 family protein -
  EL099_RS05835 (NCTC7988_01106) rinB 1131151..1131324 (+) 174 WP_126525404.1 transcriptional activator RinB -
  EL099_RS05840 (NCTC7988_01107) - 1131325..1131690 (+) 366 WP_126509065.1 hypothetical protein -
  EL099_RS05845 (NCTC7988_01108) - 1131691..1131837 (+) 147 WP_031765539.1 hypothetical protein -
  EL099_RS05850 (NCTC7988_01109) - 1131861..1132283 (+) 423 WP_126509064.1 DUF1492 domain-containing protein -
  EL099_RS05855 (NCTC7988_01110) - 1132471..1132965 (+) 495 WP_024273317.1 terminase small subunit -
  EL099_RS05860 (NCTC7988_01111) - 1132968..1134263 (+) 1296 WP_069993745.1 PBSX family phage terminase large subunit -
  EL099_RS05865 (NCTC7988_01112) - 1134274..1135809 (+) 1536 WP_126525406.1 phage portal protein -
  EL099_RS05870 (NCTC7988_01113) - 1135816..1136811 (+) 996 WP_069993747.1 minor capsid protein -
  EL099_RS05875 (NCTC7988_01114) - 1136884..1137054 (+) 171 WP_000072207.1 hypothetical protein -
  EL099_RS14965 - 1137082..1137169 (+) 88 Protein_1108 hypothetical protein -
  EL099_RS05880 (NCTC7988_01115) - 1137163..1137783 (+) 621 WP_069993748.1 DUF4355 domain-containing protein -
  EL099_RS05885 (NCTC7988_01116) - 1137797..1138771 (+) 975 WP_069993749.1 phage major capsid protein -
  EL099_RS05890 (NCTC7988_01117) - 1138793..1139080 (+) 288 WP_031786118.1 hypothetical protein -
  EL099_RS05895 (NCTC7988_01118) - 1139089..1139421 (+) 333 WP_061735286.1 phage head-tail connector protein -
  EL099_RS05900 (NCTC7988_01119) - 1139418..1139720 (+) 303 WP_061735285.1 hypothetical protein -
  EL099_RS05905 (NCTC7988_01120) - 1139720..1140067 (+) 348 WP_001017820.1 HK97-gp10 family putative phage morphogenesis protein -
  EL099_RS05910 (NCTC7988_01121) - 1140079..1140462 (+) 384 WP_000188647.1 hypothetical protein -
  EL099_RS05915 (NCTC7988_01122) - 1140480..1141061 (+) 582 WP_069993750.1 phage major tail protein, TP901-1 family -
  EL099_RS05920 (NCTC7988_01123) - 1141123..1141488 (+) 366 WP_001100161.1 tail assembly chaperone -
  EL099_RS05925 (NCTC7988_01124) - 1141518..1141862 (+) 345 WP_000105584.1 hypothetical protein -
  EL099_RS05930 (NCTC7988_01125) - 1141879..1145346 (+) 3468 WP_126525408.1 hypothetical protein -
  EL099_RS05935 (NCTC7988_01126) - 1145359..1146306 (+) 948 WP_065315642.1 phage tail family protein -
  EL099_RS05940 (NCTC7988_01127) - 1146315..1148216 (+) 1902 WP_065315643.1 SGNH/GDSL hydrolase family protein -
  EL099_RS05945 (NCTC7988_01128) - 1148231..1150141 (+) 1911 WP_069993752.1 hypothetical protein -
  EL099_RS05950 (NCTC7988_01129) - 1150141..1151964 (+) 1824 WP_126509061.1 phage baseplate upper protein -
  EL099_RS05955 (NCTC7988_01130) - 1151964..1152341 (+) 378 WP_065315646.1 DUF2977 domain-containing protein -
  EL099_RS05960 (NCTC7988_01131) - 1152351..1152524 (+) 174 WP_078098837.1 XkdX family protein -
  EL099_RS05965 (NCTC7988_01132) - 1152564..1152869 (+) 306 WP_000467322.1 DUF2951 family protein -
  EL099_RS05970 (NCTC7988_01133) - 1153006..1154910 (+) 1905 WP_069993754.1 glucosaminidase domain-containing protein -
  EL099_RS14970 - 1154923..1155534 (+) 612 Protein_1128 BppU family phage baseplate upper protein -
  EL099_RS05980 (NCTC7988_01135) - 1156986..1157423 (+) 438 WP_126509059.1 phage holin -
  EL099_RS05985 (NCTC7988_01136) - 1157404..1158849 (+) 1446 WP_126509058.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 139 a.a.        Molecular weight: 15606.24 Da        Isoelectric Point: 7.0171

>NTDB_id=1119700 EL099_RS05745 WP_000934796.1 1123588..1124007(+) (ssbA) [Staphylococcus aureus strain NCTC7988]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEEDFSDLPF

Nucleotide


Download         Length: 420 bp        

>NTDB_id=1119700 EL099_RS05745 WP_000934796.1 1123588..1124007(+) (ssbA) [Staphylococcus aureus strain NCTC7988]
ATGTTAAACAGAGTAGTTTTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGC
AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTTCAATTCTTAGAACCGAAGAA
TAACAACAAACAGAATAACCAACAACACAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGAAGACT
TTTCTGACTTACCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

80.374

76.978

0.619

  ssb Latilactobacillus sakei subsp. sakei 23K

53.947

100

0.59

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.091

79.137

0.468

  ssbB/cilA Streptococcus mitis SK321

40.288

100

0.403

  ssbA Streptococcus mutans UA159

45.378

85.612

0.388

  ssbB Streptococcus sobrinus strain NIDR 6715-7

49.057

76.259

0.374


Multiple sequence alignment