Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACOCJA_RS14145 | Genome accession | NZ_CP184565 |
| Coordinates | 2836371..2836841 (+) | Length | 156 a.a. |
| NCBI ID | WP_017466775.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain CBTW2018043 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2814639..2843104 | 2836371..2836841 | within | 0 |
Gene organization within MGE regions
Location: 2814639..2843104
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACOCJA_RS14005 (ACOCJA_14005) | groES | 2814639..2814923 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| ACOCJA_RS14010 (ACOCJA_14010) | groL | 2814999..2816615 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| ACOCJA_RS14015 (ACOCJA_14015) | - | 2817156..2817335 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| ACOCJA_RS14020 (ACOCJA_14020) | - | 2817332..2817958 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| ACOCJA_RS14025 (ACOCJA_14025) | - | 2818497..2819804 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| ACOCJA_RS14030 (ACOCJA_14030) | - | 2820187..2821410 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| ACOCJA_RS14035 (ACOCJA_14035) | - | 2821842..2822897 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| ACOCJA_RS14040 (ACOCJA_14040) | - | 2822919..2823935 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| ACOCJA_RS14045 (ACOCJA_14045) | sph | 2824197..2825021 (-) | 825 | Protein_2729 | sphingomyelin phosphodiesterase | - |
| ACOCJA_RS14050 (ACOCJA_14050) | - | 2825078..2826115 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| ACOCJA_RS14055 (ACOCJA_14055) | - | 2826174..2826638 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| ACOCJA_RS14060 (ACOCJA_14060) | - | 2826738..2826920 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| ACOCJA_RS14065 (ACOCJA_14065) | - | 2826965..2827822 (-) | 858 | WP_000804507.1 | HIRAN domain-containing protein | - |
| ACOCJA_RS14070 (ACOCJA_14070) | - | 2827834..2828550 (-) | 717 | WP_420228252.1 | LexA family transcriptional regulator | - |
| ACOCJA_RS14075 (ACOCJA_14075) | - | 2828714..2828956 (+) | 243 | WP_000639927.1 | DUF739 family protein | - |
| ACOCJA_RS14080 (ACOCJA_14080) | - | 2828970..2829230 (+) | 261 | Protein_2736 | transcriptional regulator | - |
| ACOCJA_RS14085 (ACOCJA_14085) | - | 2829254..2829793 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| ACOCJA_RS14090 (ACOCJA_14090) | - | 2829850..2830605 (+) | 756 | WP_001148341.1 | phage antirepressor KilAC domain-containing protein | - |
| ACOCJA_RS14095 (ACOCJA_14095) | - | 2830621..2830818 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| ACOCJA_RS14100 (ACOCJA_14100) | - | 2830849..2830989 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| ACOCJA_RS14105 (ACOCJA_14105) | - | 2831004..2831636 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| ACOCJA_RS14110 (ACOCJA_14110) | - | 2831695..2832015 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| ACOCJA_RS14115 (ACOCJA_14115) | - | 2832012..2832173 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| ACOCJA_RS14120 (ACOCJA_14120) | - | 2832266..2832526 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| ACOCJA_RS14125 (ACOCJA_14125) | - | 2832535..2832798 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| ACOCJA_RS14130 (ACOCJA_14130) | - | 2832807..2834750 (+) | 1944 | WP_103146213.1 | AAA family ATPase | - |
| ACOCJA_RS14135 (ACOCJA_14135) | - | 2834752..2835672 (+) | 921 | WP_103146214.1 | recombinase RecT | - |
| ACOCJA_RS14140 (ACOCJA_14140) | - | 2835753..2836370 (+) | 618 | WP_224211742.1 | MBL fold metallo-hydrolase | - |
| ACOCJA_RS14145 (ACOCJA_14145) | ssbA | 2836371..2836841 (+) | 471 | WP_017466775.1 | single-stranded DNA-binding protein | Machinery gene |
| ACOCJA_RS14150 (ACOCJA_14150) | - | 2836871..2837755 (+) | 885 | WP_103146215.1 | DnaD domain protein | - |
| ACOCJA_RS14155 (ACOCJA_14155) | - | 2837762..2837980 (+) | 219 | WP_053819389.1 | hypothetical protein | - |
| ACOCJA_RS14160 (ACOCJA_14160) | - | 2837989..2838393 (+) | 405 | WP_103146216.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACOCJA_RS14165 (ACOCJA_14165) | - | 2838406..2838774 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACOCJA_RS14170 (ACOCJA_14170) | - | 2838778..2839020 (+) | 243 | WP_000131379.1 | phi PVL orf 51-like protein | - |
| ACOCJA_RS14175 (ACOCJA_14175) | - | 2839029..2839400 (+) | 372 | WP_001557190.1 | hypothetical protein | - |
| ACOCJA_RS14180 (ACOCJA_14180) | - | 2839393..2839644 (+) | 252 | WP_001836226.1 | DUF1024 family protein | - |
| ACOCJA_RS14185 (ACOCJA_14185) | - | 2839634..2839816 (+) | 183 | WP_000028421.1 | hypothetical protein | - |
| ACOCJA_RS14190 (ACOCJA_14190) | - | 2839809..2840318 (+) | 510 | WP_031866561.1 | dUTP diphosphatase | - |
| ACOCJA_RS14195 (ACOCJA_14195) | - | 2840355..2840507 (+) | 153 | WP_031768020.1 | DUF1381 domain-containing protein | - |
| ACOCJA_RS14200 (ACOCJA_14200) | - | 2840500..2840958 (+) | 459 | WP_031768021.1 | hypothetical protein | - |
| ACOCJA_RS14205 (ACOCJA_14205) | rinB | 2840971..2841120 (+) | 150 | WP_070030217.1 | transcriptional activator RinB | - |
| ACOCJA_RS14210 (ACOCJA_14210) | - | 2841279..2841929 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| ACOCJA_RS14215 (ACOCJA_14215) | - | 2841929..2842129 (+) | 201 | WP_103146217.1 | DUF1514 family protein | - |
| ACOCJA_RS14220 (ACOCJA_14220) | - | 2842157..2842573 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| ACOCJA_RS14225 (ACOCJA_14225) | - | 2842805..2843104 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17730.57 Da Isoelectric Point: 4.7821
>NTDB_id=1109652 ACOCJA_RS14145 WP_017466775.1 2836371..2836841(+) (ssbA) [Staphylococcus aureus strain CBTW2018043]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1109652 ACOCJA_RS14145 WP_017466775.1 2836371..2836841(+) (ssbA) [Staphylococcus aureus strain CBTW2018043]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.577 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
34.682 |
100 |
0.385 |
| ssb | Neisseria gonorrhoeae MS11 |
34.682 |
100 |
0.385 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |