Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACOCJB_RS00325 | Genome accession | NZ_CP184557 |
| Coordinates | 61404..61874 (+) | Length | 156 a.a. |
| NCBI ID | WP_017466775.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SCTW2018482 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 36674..92093 | 61404..61874 | within | 0 |
Gene organization within MGE regions
Location: 36674..92093
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACOCJB_RS00170 (ACOCJB_00170) | - | 36674..37300 (-) | 627 | WP_000522384.1 | nitroreductase family protein | - |
| ACOCJB_RS00175 (ACOCJB_00175) | - | 37497..38729 (+) | 1233 | WP_183137443.1 | SdrH family protein | - |
| ACOCJB_RS00180 (ACOCJB_00180) | mroQ | 38754..39497 (-) | 744 | WP_000197638.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| ACOCJB_RS00185 (ACOCJB_00185) | groES | 39672..39956 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| ACOCJB_RS00190 (ACOCJB_00190) | groL | 40032..41648 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| ACOCJB_RS00195 (ACOCJB_00195) | - | 42189..42368 (+) | 180 | WP_000201398.1 | hypothetical protein | - |
| ACOCJB_RS00200 (ACOCJB_00200) | - | 42365..42991 (+) | 627 | WP_000216896.1 | hypothetical protein | - |
| ACOCJB_RS00205 (ACOCJB_00205) | - | 43530..44837 (-) | 1308 | WP_001045074.1 | TrkH family potassium uptake protein | - |
| ACOCJB_RS00210 (ACOCJB_00210) | - | 45220..46443 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| ACOCJB_RS00215 (ACOCJB_00215) | - | 46875..47930 (+) | 1056 | WP_000791397.1 | leukocidin family pore-forming toxin | - |
| ACOCJB_RS00220 (ACOCJB_00220) | - | 47952..48968 (+) | 1017 | WP_000595612.1 | leukocidin/hemolysin toxin family protein | - |
| ACOCJB_RS00225 (ACOCJB_00225) | sph | 49230..50054 (-) | 825 | Protein_41 | sphingomyelin phosphodiesterase | - |
| ACOCJB_RS00230 (ACOCJB_00230) | - | 50111..51148 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| ACOCJB_RS00235 (ACOCJB_00235) | - | 51207..51671 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| ACOCJB_RS00240 (ACOCJB_00240) | - | 51771..51953 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| ACOCJB_RS00245 (ACOCJB_00245) | - | 51998..52855 (-) | 858 | WP_000804507.1 | HIRAN domain-containing protein | - |
| ACOCJB_RS00250 (ACOCJB_00250) | - | 52867..53583 (-) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| ACOCJB_RS00255 (ACOCJB_00255) | - | 53747..53989 (+) | 243 | WP_000639927.1 | DUF739 family protein | - |
| ACOCJB_RS00260 (ACOCJB_00260) | - | 54003..54263 (+) | 261 | Protein_48 | transcriptional regulator | - |
| ACOCJB_RS00265 (ACOCJB_00265) | - | 54287..54826 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| ACOCJB_RS00270 (ACOCJB_00270) | - | 54883..55638 (+) | 756 | WP_001148341.1 | phage antirepressor KilAC domain-containing protein | - |
| ACOCJB_RS00275 (ACOCJB_00275) | - | 55654..55851 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| ACOCJB_RS00280 (ACOCJB_00280) | - | 55882..56022 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| ACOCJB_RS00285 (ACOCJB_00285) | - | 56037..56669 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| ACOCJB_RS00290 (ACOCJB_00290) | - | 56728..57048 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| ACOCJB_RS00295 (ACOCJB_00295) | - | 57045..57206 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| ACOCJB_RS00300 (ACOCJB_00300) | - | 57299..57559 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| ACOCJB_RS00305 (ACOCJB_00305) | - | 57568..57831 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| ACOCJB_RS00310 (ACOCJB_00310) | - | 57840..59783 (+) | 1944 | WP_103146213.1 | AAA family ATPase | - |
| ACOCJB_RS00315 (ACOCJB_00315) | - | 59785..60705 (+) | 921 | WP_103146214.1 | recombinase RecT | - |
| ACOCJB_RS00320 (ACOCJB_00320) | - | 60786..61403 (+) | 618 | WP_224211742.1 | MBL fold metallo-hydrolase | - |
| ACOCJB_RS00325 (ACOCJB_00325) | ssbA | 61404..61874 (+) | 471 | WP_017466775.1 | single-stranded DNA-binding protein | Machinery gene |
| ACOCJB_RS00330 (ACOCJB_00330) | - | 61904..62788 (+) | 885 | WP_103146215.1 | DnaD domain protein | - |
| ACOCJB_RS00335 (ACOCJB_00335) | - | 62795..63013 (+) | 219 | WP_053819389.1 | hypothetical protein | - |
| ACOCJB_RS00340 (ACOCJB_00340) | - | 63022..63426 (+) | 405 | WP_103146216.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACOCJB_RS00345 (ACOCJB_00345) | - | 63439..63807 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACOCJB_RS00350 (ACOCJB_00350) | - | 63811..64053 (+) | 243 | WP_000131379.1 | phi PVL orf 51-like protein | - |
| ACOCJB_RS00355 (ACOCJB_00355) | - | 64062..64433 (+) | 372 | WP_001557190.1 | hypothetical protein | - |
| ACOCJB_RS00360 (ACOCJB_00360) | - | 64426..64677 (+) | 252 | WP_001836226.1 | DUF1024 family protein | - |
| ACOCJB_RS00365 (ACOCJB_00365) | - | 64667..64849 (+) | 183 | WP_000028421.1 | hypothetical protein | - |
| ACOCJB_RS00370 (ACOCJB_00370) | - | 64842..65351 (+) | 510 | WP_031866561.1 | dUTP diphosphatase | - |
| ACOCJB_RS00375 (ACOCJB_00375) | - | 65388..65540 (+) | 153 | WP_031768020.1 | DUF1381 domain-containing protein | - |
| ACOCJB_RS00380 (ACOCJB_00380) | - | 65533..65991 (+) | 459 | WP_031768021.1 | hypothetical protein | - |
| ACOCJB_RS00385 (ACOCJB_00385) | rinB | 66004..66153 (+) | 150 | WP_070030217.1 | transcriptional activator RinB | - |
| ACOCJB_RS00390 (ACOCJB_00390) | - | 66312..66962 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| ACOCJB_RS00395 (ACOCJB_00395) | - | 66962..67162 (+) | 201 | WP_103146217.1 | DUF1514 family protein | - |
| ACOCJB_RS00400 (ACOCJB_00400) | - | 67190..67606 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| ACOCJB_RS00405 (ACOCJB_00405) | - | 67838..68137 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
| ACOCJB_RS00410 (ACOCJB_00410) | - | 68267..68611 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| ACOCJB_RS00415 (ACOCJB_00415) | - | 68608..70269 (+) | 1662 | WP_103146218.1 | terminase large subunit | - |
| ACOCJB_RS00420 (ACOCJB_00420) | - | 70285..71472 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| ACOCJB_RS00425 (ACOCJB_00425) | - | 71456..72193 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| ACOCJB_RS00430 (ACOCJB_00430) | - | 72217..73362 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| ACOCJB_RS00435 (ACOCJB_00435) | - | 73382..73666 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| ACOCJB_RS00440 (ACOCJB_00440) | - | 73656..73940 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| ACOCJB_RS00445 (ACOCJB_00445) | - | 73924..74286 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| ACOCJB_RS00450 (ACOCJB_00450) | - | 74283..74687 (+) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| ACOCJB_RS00455 (ACOCJB_00455) | - | 74684..75091 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| ACOCJB_RS00460 (ACOCJB_00460) | - | 75092..75736 (+) | 645 | WP_000268740.1 | major tail protein | - |
| ACOCJB_RS00465 (ACOCJB_00465) | - | 75772..76002 (+) | 231 | Protein_89 | Ig-like domain-containing protein | - |
| ACOCJB_RS00470 (ACOCJB_00470) | gpG | 76052..76402 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| ACOCJB_RS00475 (ACOCJB_00475) | gpGT | 76453..76590 (+) | 138 | WP_180992418.1 | phage tail assembly chaperone GT | - |
| ACOCJB_RS00480 (ACOCJB_00480) | - | 76647..81176 (+) | 4530 | WP_103146220.1 | phage tail tape measure protein | - |
| ACOCJB_RS00485 (ACOCJB_00485) | - | 81173..82657 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| ACOCJB_RS00490 (ACOCJB_00490) | - | 82673..86458 (+) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| ACOCJB_RS00495 (ACOCJB_00495) | - | 86448..86600 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| ACOCJB_RS00500 (ACOCJB_00500) | - | 86647..86934 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| ACOCJB_RS00505 (ACOCJB_00505) | - | 86992..87288 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| ACOCJB_RS00510 (ACOCJB_00510) | pepG1 | 87480..87614 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| ACOCJB_RS00515 (ACOCJB_00515) | - | 87667..87774 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| ACOCJB_RS00520 (ACOCJB_00520) | - | 87826..88080 (+) | 255 | WP_000611512.1 | phage holin | - |
| ACOCJB_RS00525 (ACOCJB_00525) | - | 88092..88847 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| ACOCJB_RS00530 (ACOCJB_00530) | sak | 89038..89529 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| ACOCJB_RS00535 (ACOCJB_00535) | - | 90176..90514 (+) | 339 | Protein_103 | SH3 domain-containing protein | - |
| ACOCJB_RS00540 (ACOCJB_00540) | - | 90609..91058 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| ACOCJB_RS00545 (ACOCJB_00545) | scn | 91743..92093 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17730.57 Da Isoelectric Point: 4.7821
>NTDB_id=1109431 ACOCJB_RS00325 WP_017466775.1 61404..61874(+) (ssbA) [Staphylococcus aureus strain SCTW2018482]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1109431 ACOCJB_RS00325 WP_017466775.1 61404..61874(+) (ssbA) [Staphylococcus aureus strain SCTW2018482]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.577 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
34.682 |
100 |
0.385 |
| ssb | Neisseria gonorrhoeae MS11 |
34.682 |
100 |
0.385 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |