Detailed information
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | ACMS1Y_RS16820 | Genome accession | NZ_CP181431 |
| Coordinates | 3262669..3262824 (-) | Length | 51 a.a. |
| NCBI ID | WP_277722747.1 | Uniprot ID | - |
| Organism | Bacillus safensis strain BS22LVI | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3262193..3281487 | 3262669..3262824 | within | 0 |
Gene organization within MGE regions
Location: 3262193..3281487
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACMS1Y_RS16815 | - | 3262193..3262612 (-) | 420 | WP_024423621.1 | TIGR03826 family flagellar region protein | - |
| ACMS1Y_RS16820 | comFC | 3262669..3262824 (-) | 156 | WP_277722747.1 | ComF family protein | Machinery gene |
| ACMS1Y_RS16825 | - | 3262836..3263324 (-) | 489 | WP_415316066.1 | ComF family protein | - |
| ACMS1Y_RS16830 | - | 3263351..3263644 (-) | 294 | WP_254965333.1 | late competence development ComFB family protein | - |
| ACMS1Y_RS16835 | epsC | 3263969..3264817 (-) | 849 | WP_254965332.1 | serine O-acetyltransferase EpsC | - |
| ACMS1Y_RS16840 | pyrH | 3264918..3265658 (+) | 741 | WP_254965331.1 | UMP kinase | - |
| ACMS1Y_RS16845 | - | 3265714..3266892 (-) | 1179 | WP_254965329.1 | MFS transporter | - |
| ACMS1Y_RS16850 | - | 3266955..3267875 (-) | 921 | WP_254965327.1 | phosphotransferase | - |
| ACMS1Y_RS16855 | - | 3267890..3269065 (-) | 1176 | WP_254965326.1 | ATP-grasp domain-containing protein | - |
| ACMS1Y_RS16860 | - | 3269067..3270287 (-) | 1221 | WP_254965324.1 | ATP-grasp domain-containing protein | - |
| ACMS1Y_RS16865 | - | 3270298..3271893 (-) | 1596 | WP_254965322.1 | class I adenylate-forming enzyme family protein | - |
| ACMS1Y_RS16870 | - | 3271933..3272190 (-) | 258 | WP_254965320.1 | acyl carrier protein | - |
| ACMS1Y_RS16875 | - | 3272187..3272489 (-) | 303 | WP_415316068.1 | SDR family oxidoreductase | - |
| ACMS1Y_RS16880 | - | 3272504..3272908 (-) | 405 | WP_415316069.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| ACMS1Y_RS16885 | - | 3272909..3273877 (-) | 969 | WP_254965317.1 | alpha/beta hydrolase | - |
| ACMS1Y_RS16890 | - | 3273882..3275399 (-) | 1518 | WP_254965315.1 | NAD(P)-dependent oxidoreductase | - |
| ACMS1Y_RS16895 | - | 3275414..3276109 (-) | 696 | WP_254965312.1 | hypothetical protein | - |
| ACMS1Y_RS16900 | - | 3276121..3276969 (-) | 849 | WP_254965310.1 | NAD(P)-dependent oxidoreductase | - |
| ACMS1Y_RS16905 | - | 3276973..3278448 (-) | 1476 | WP_254965308.1 | nucleoside monophosphate kinase | - |
| ACMS1Y_RS16910 | - | 3278445..3279557 (-) | 1113 | WP_254965306.1 | nucleotidyltransferase family protein | - |
| ACMS1Y_RS16915 | - | 3279554..3279856 (-) | 303 | WP_254965304.1 | Dabb family protein | - |
| ACMS1Y_RS16920 | - | 3280645..3281487 (-) | 843 | WP_254965302.1 | DegV family protein | - |
Sequence
Protein
Download Length: 51 a.a. Molecular weight: 5634.49 Da Isoelectric Point: 6.1124
>NTDB_id=1100119 ACMS1Y_RS16820 WP_277722747.1 3262669..3262824(-) (comFC) [Bacillus safensis strain BS22LVI]
MFQIKQTDAIVQRDIILVDDIYTTGATIYDAARILKDAGAKSVSSFTLIRS
MFQIKQTDAIVQRDIILVDDIYTTGATIYDAARILKDAGAKSVSSFTLIRS
Nucleotide
Download Length: 156 bp
>NTDB_id=1100119 ACMS1Y_RS16820 WP_277722747.1 3262669..3262824(-) (comFC) [Bacillus safensis strain BS22LVI]
TTGTTTCAAATAAAGCAAACAGATGCGATTGTTCAAAGGGATATTATATTAGTTGATGATATCTATACAACGGGAGCAAC
CATCTATGATGCGGCAAGAATTTTGAAAGACGCAGGTGCTAAAAGTGTTTCTTCTTTTACGTTGATACGTAGTTAA
TTGTTTCAAATAAAGCAAACAGATGCGATTGTTCAAAGGGATATTATATTAGTTGATGATATCTATACAACGGGAGCAAC
CATCTATGATGCGGCAAGAATTTTGAAAGACGCAGGTGCTAAAAGTGTTTCTTCTTTTACGTTGATACGTAGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Bacillus subtilis subsp. subtilis str. 168 |
69.231 |
76.471 |
0.529 |
| comFC | Lactococcus lactis subsp. cremoris KW2 |
46.939 |
96.078 |
0.451 |
| comFC/cflB | Streptococcus pneumoniae D39 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus pneumoniae R6 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus pneumoniae TIGR4 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus pneumoniae Rx1 |
46.667 |
88.235 |
0.412 |
| comFC/cflB | Streptococcus mitis SK321 |
47.5 |
78.431 |
0.373 |
| comFC/cflB | Streptococcus mitis NCTC 12261 |
42.222 |
88.235 |
0.373 |