Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACKTWR_RS37820 Genome accession   NZ_AP031304
Coordinates   7441271..7441765 (-) Length   164 a.a.
NCBI ID   WP_213429270.1    Uniprot ID   -
Organism   Paenibacillus melissococcoides strain J22TS4     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 7388653..7451351 7441271..7441765 within 0


Gene organization within MGE regions


Location: 7388653..7451351
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKTWR_RS37500 (PMJ22TS4_75990) - 7388653..7389090 (-) 438 WP_213431440.1 helix-turn-helix domain-containing protein -
  ACKTWR_RS37505 (PMJ22TS4_76000) - 7389317..7389634 (+) 318 WP_261945210.1 hypothetical protein -
  ACKTWR_RS37510 (PMJ22TS4_76010) - 7389631..7389843 (+) 213 WP_213431526.1 helix-turn-helix domain-containing protein -
  ACKTWR_RS37515 (PMJ22TS4_76020) - 7390020..7392089 (+) 2070 WP_261945356.1 Mu transposase C-terminal domain-containing protein -
  ACKTWR_RS37520 (PMJ22TS4_76030) - 7392105..7393085 (+) 981 WP_261945208.1 AAA family ATPase -
  ACKTWR_RS37525 (PMJ22TS4_76040) - 7393097..7393450 (+) 354 WP_261945355.1 hypothetical protein -
  ACKTWR_RS37530 (PMJ22TS4_76060) - 7393575..7393865 (+) 291 WP_390905354.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  ACKTWR_RS37535 (PMJ22TS4_76070) - 7393862..7394491 (+) 630 WP_261945354.1 ABC transporter permease -
  ACKTWR_RS37540 (PMJ22TS4_76080) - 7394503..7394907 (+) 405 WP_213431500.1 phage protein GemA/Gp16 family protein -
  ACKTWR_RS37545 (PMJ22TS4_76100) - 7395144..7395992 (+) 849 WP_213431502.1 ATP-binding protein -
  ACKTWR_RS37550 (PMJ22TS4_76110) - 7396012..7396200 (+) 189 WP_213431369.1 hypothetical protein -
  ACKTWR_RS37555 (PMJ22TS4_76120) - 7396224..7396658 (+) 435 WP_261945204.1 hypothetical protein -
  ACKTWR_RS37560 - 7396658..7396888 (+) 231 WP_407873262.1 hypothetical protein -
  ACKTWR_RS37565 - 7396914..7397651 (+) 738 WP_261945203.1 N-acetylmuramoyl-L-alanine amidase family protein -
  ACKTWR_RS37570 (PMJ22TS4_76150) - 7397694..7398020 (+) 327 WP_261945202.1 Mor transcription activator family protein -
  ACKTWR_RS37575 (PMJ22TS4_76160) - 7398133..7398561 (+) 429 WP_306433995.1 guanylate kinase -
  ACKTWR_RS37580 (PMJ22TS4_76170) - 7398561..7398824 (+) 264 WP_213431481.1 hypothetical protein -
  ACKTWR_RS37585 (PMJ22TS4_76180) - 7398825..7399142 (+) 318 WP_213431480.1 hypothetical protein -
  ACKTWR_RS37590 (PMJ22TS4_76190) - 7399142..7399702 (+) 561 WP_261945201.1 DUF3486 family protein -
  ACKTWR_RS37595 (PMJ22TS4_76200) terL 7399695..7401458 (+) 1764 WP_407873260.1 phage terminase large subunit -
  ACKTWR_RS37600 (PMJ22TS4_76210) - 7401470..7403035 (+) 1566 WP_213431335.1 DUF935 domain-containing protein -
  ACKTWR_RS37605 (PMJ22TS4_76220) - 7403019..7403756 (+) 738 WP_261948979.1 phage minor head protein -
  ACKTWR_RS37610 (PMJ22TS4_76230) - 7403876..7404907 (+) 1032 WP_261948978.1 phage protease -
  ACKTWR_RS37615 (PMJ22TS4_76240) - 7404937..7405338 (+) 402 WP_213430840.1 hypothetical protein -
  ACKTWR_RS37620 (PMJ22TS4_76250) - 7405368..7406297 (+) 930 WP_213430841.1 Mu-like prophage major head subunit gpT family protein -
  ACKTWR_RS37625 (PMJ22TS4_76260) - 7406319..7406765 (+) 447 WP_213430842.1 gp436 family protein -
  ACKTWR_RS37630 (PMJ22TS4_76270) - 7406769..7407269 (+) 501 WP_213430843.1 phage virion morphogenesis protein -
  ACKTWR_RS37635 (PMJ22TS4_76280) - 7407272..7407781 (+) 510 WP_213430844.1 SON protein -
  ACKTWR_RS37640 (PMJ22TS4_76290) - 7407765..7407983 (+) 219 WP_213430845.1 hypothetical protein -
  ACKTWR_RS37645 (PMJ22TS4_76300) - 7407976..7409391 (+) 1416 WP_213430846.1 DUF2586 domain-containing protein -
  ACKTWR_RS37650 (PMJ22TS4_76310) - 7409395..7409829 (+) 435 WP_213430847.1 hypothetical protein -
  ACKTWR_RS37655 (PMJ22TS4_76320) - 7409876..7410232 (+) 357 WP_213430848.1 hypothetical protein -
  ACKTWR_RS37660 (PMJ22TS4_76330) - 7410277..7410441 (+) 165 WP_213430856.1 hypothetical protein -
  ACKTWR_RS37665 (PMJ22TS4_76340) - 7410454..7410693 (-) 240 WP_213430849.1 hypothetical protein -
  ACKTWR_RS37670 (PMJ22TS4_76350) - 7410839..7413148 (+) 2310 WP_407873208.1 phage tail tape measure protein -
  ACKTWR_RS37675 (PMJ22TS4_76360) - 7413145..7413759 (+) 615 WP_213430851.1 transcriptional regulator -
  ACKTWR_RS37680 (PMJ22TS4_76370) - 7413771..7414526 (+) 756 WP_261945408.1 serine/arginine repetitive matrix protein 2 -
  ACKTWR_RS37685 (PMJ22TS4_76380) - 7414540..7414830 (+) 291 WP_213430852.1 hypothetical protein -
  ACKTWR_RS37690 (PMJ22TS4_76390) - 7414830..7415243 (+) 414 WP_213430853.1 DUF2634 domain-containing protein -
  ACKTWR_RS37695 (PMJ22TS4_76400) - 7415236..7416363 (+) 1128 WP_261944656.1 baseplate J/gp47 family protein -
  ACKTWR_RS37700 (PMJ22TS4_76410) - 7416368..7417054 (+) 687 WP_213431380.1 hypothetical protein -
  ACKTWR_RS37705 (PMJ22TS4_76420) - 7417051..7417371 (+) 321 WP_213431381.1 hypothetical protein -
  ACKTWR_RS37710 (PMJ22TS4_76430) - 7417361..7418653 (+) 1293 WP_213431382.1 phage tail protein -
  ACKTWR_RS37715 (PMJ22TS4_76440) - 7418665..7419009 (+) 345 WP_213431383.1 hypothetical protein -
  ACKTWR_RS37720 (PMJ22TS4_76460) - 7419218..7419934 (+) 717 Protein_7427 YhgE/Pip family protein -
  ACKTWR_RS37725 (PMJ22TS4_76470) - 7420045..7421353 (+) 1309 Protein_7428 MFS transporter -
  ACKTWR_RS37730 (PMJ22TS4_76490) - 7422070..7422240 (-) 171 WP_006678705.1 CxxH/CxxC protein -
  ACKTWR_RS37735 (PMJ22TS4_76500) - 7422368..7423612 (-) 1245 WP_213429283.1 S1C family serine protease -
  ACKTWR_RS37740 (PMJ22TS4_76510) - 7423879..7424085 (+) 207 WP_006678707.1 hypothetical protein -
  ACKTWR_RS37745 (PMJ22TS4_76520) - 7424057..7424878 (-) 822 WP_213429282.1 MBL fold metallo-hydrolase -
  ACKTWR_RS37750 (PMJ22TS4_76530) yycI 7424875..7425621 (-) 747 WP_213429281.1 two-component system regulatory protein YycI -
  ACKTWR_RS37755 (PMJ22TS4_76540) - 7425676..7426983 (-) 1308 WP_213429280.1 YycH family regulatory protein -
  ACKTWR_RS37760 (PMJ22TS4_76550) walK 7426980..7428833 (-) 1854 WP_213429279.1 cell wall metabolism sensor histidine kinase WalK -
  ACKTWR_RS37765 (PMJ22TS4_76560) yycF 7428834..7429568 (-) 735 WP_213429278.1 response regulator YycF -
  ACKTWR_RS37770 (PMJ22TS4_76570) - 7429822..7431354 (-) 1533 WP_213429277.1 peptidoglycan DD-metalloendopeptidase family protein -
  ACKTWR_RS37775 (PMJ22TS4_76580) - 7431733..7432398 (-) 666 WP_213429276.1 spore coat protein -
  ACKTWR_RS37780 (PMJ22TS4_76590) - 7432555..7433838 (-) 1284 WP_213429275.1 adenylosuccinate synthase -
  ACKTWR_RS37785 (PMJ22TS4_76600) dnaB 7434014..7435369 (-) 1356 WP_197256933.1 replicative DNA helicase -
  ACKTWR_RS37790 (PMJ22TS4_76610) rplI 7435371..7435814 (-) 444 WP_197256935.1 50S ribosomal protein L9 -
  ACKTWR_RS37795 (PMJ22TS4_76620) - 7435811..7437769 (-) 1959 WP_213429274.1 DHH family phosphoesterase -
  ACKTWR_RS37800 (PMJ22TS4_76630) - 7437781..7438707 (-) 927 WP_213429273.1 DUF2232 domain-containing protein -
  ACKTWR_RS37805 (PMJ22TS4_76640) - 7438835..7439257 (-) 423 WP_213429272.1 CBS domain-containing protein -
  ACKTWR_RS37810 (PMJ22TS4_76650) - 7439376..7440353 (-) 978 WP_213429271.1 LCP family protein -
  ACKTWR_RS37815 (PMJ22TS4_76660) rpsR 7440975..7441250 (-) 276 WP_006678722.1 30S ribosomal protein S18 -
  ACKTWR_RS37820 (PMJ22TS4_76670) ssbA 7441271..7441765 (-) 495 WP_213429270.1 single-stranded DNA-binding protein Machinery gene
  ACKTWR_RS37825 (PMJ22TS4_76680) rpsF 7441813..7442100 (-) 288 WP_168178522.1 30S ribosomal protein S6 -
  ACKTWR_RS37830 - 7442376..7442575 (+) 200 Protein_7449 YjzC family protein -
  ACKTWR_RS37840 (PMJ22TS4_76690) - 7443289..7443507 (-) 219 WP_213429269.1 DUF951 domain-containing protein -
  ACKTWR_RS37845 (PMJ22TS4_76700) - 7443497..7444426 (-) 930 WP_213429268.1 mechanosensitive ion channel family protein -
  ACKTWR_RS37850 (PMJ22TS4_76710) - 7444431..7444706 (-) 276 WP_213429267.1 DUF3343 domain-containing protein -
  ACKTWR_RS37855 (PMJ22TS4_76720) yyaC 7444813..7445400 (+) 588 WP_213429266.1 spore protease YyaC -
  ACKTWR_RS37860 (PMJ22TS4_76730) - 7445397..7445858 (-) 462 WP_373871484.1 DUF4446 family protein -
  ACKTWR_RS37865 (PMJ22TS4_76740) - 7445952..7447121 (-) 1170 WP_213429264.1 aminotransferase class V-fold PLP-dependent enzyme -
  ACKTWR_RS37870 (PMJ22TS4_76750) - 7447340..7448194 (-) 855 WP_213429263.1 ParB/RepB/Spo0J family partition protein -
  ACKTWR_RS37875 (PMJ22TS4_76760) - 7448187..7448948 (-) 762 WP_006678734.1 ParA family protein -
  ACKTWR_RS37880 (PMJ22TS4_76770) noc 7449143..7449958 (-) 816 WP_213429262.1 nucleoid occlusion protein -
  ACKTWR_RS37885 (PMJ22TS4_76780) - 7450229..7450660 (-) 432 WP_213429261.1 hypothetical protein -
  ACKTWR_RS37890 (PMJ22TS4_76790) - 7450693..7450878 (-) 186 WP_213429260.1 hypothetical protein -

Sequence


Protein


Download         Length: 164 a.a.        Molecular weight: 18070.87 Da        Isoelectric Point: 5.0078

>NTDB_id=108596 ACKTWR_RS37820 WP_213429270.1 7441271..7441765(-) (ssbA) [Paenibacillus melissococcoides strain J22TS4]
MLNRVILIGRLTRDPELRYTPSGVAVTQFTLAVDRPFSNQNGEREADFIPVVTWRQLAETCANYLRKGRLTAVEGRIQVR
SYDNNEGKRVYVTEVIADNVRFLESNRDSGGRRDDMGGGYGGGQPNNNSRPYGGGGSSQSRGPAADPFSDDGRPIDISDD
DLPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=108596 ACKTWR_RS37820 WP_213429270.1 7441271..7441765(-) (ssbA) [Paenibacillus melissococcoides strain J22TS4]
ATGTTGAATCGCGTGATCTTGATTGGTCGTCTAACCCGTGACCCTGAATTGCGCTATACGCCATCCGGAGTTGCTGTGAC
GCAATTTACGTTGGCGGTCGATCGTCCGTTCTCGAACCAGAATGGCGAGCGGGAGGCGGATTTCATTCCCGTGGTCACAT
GGCGGCAGTTGGCAGAGACTTGCGCCAATTATTTGCGCAAAGGTCGGCTAACGGCCGTGGAAGGCCGAATCCAAGTCCGC
AGTTACGACAACAATGAAGGGAAGCGCGTATACGTTACGGAGGTTATCGCCGATAATGTGCGATTCCTGGAGTCCAACCG
CGACAGCGGAGGAAGACGTGACGATATGGGCGGAGGTTATGGCGGCGGACAGCCGAACAATAACTCGCGGCCATATGGCG
GAGGAGGCTCTAGCCAGTCCCGCGGTCCGGCAGCGGATCCATTCTCTGACGACGGCAGACCGATCGATATATCTGATGAT
GATTTGCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.07

100

0.567

  ssb Latilactobacillus sakei subsp. sakei 23K

49.412

100

0.512

  ssb Neisseria meningitidis MC58

36.413

100

0.409

  ssb Neisseria gonorrhoeae MS11

36.413

100

0.409

  ssb Glaesserella parasuis strain SC1401

33.702

100

0.372

  ssbB Bacillus subtilis subsp. subtilis str. 168

57.692

63.415

0.366


Multiple sequence alignment